SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005025 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005025
Domain Number 1 Region: 405-808
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-135
Family Ankyrin repeat 0.0000000000125
Further Details:      
 
Domain Number 2 Region: 172-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.97e-77
Family Ankyrin repeat 0.00000285
Further Details:      
 
Domain Number 3 Region: 16-246
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-60
Family Ankyrin repeat 0.0000214
Further Details:      
 
Domain Number 4 Region: 1415-1498
Classification Level Classification E-value
Superfamily DEATH domain 3.36e-20
Family DEATH domain, DD 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005025   Gene: ENSONIG00000003990   Transcript: ENSONIT00000005029
Sequence length 1612
Comment pep:known_by_projection scaffold:Orenil1.0:GL831163.1:3665581:3706437:1 gene:ENSONIG00000003990 transcript:ENSONIT00000005029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPLLHLLQADAATSFLRAARSGNLDKALDHIKNGIDINIANQNGLNGLHLASKEGHVKM
VLELLHAGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQ
ENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIA
ARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGI
TPLHIASRRGNVMMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRIIEILLEHGAPIQA
KTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDK
GAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIV
KNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNSAQVDAKAKDDQTPLHCAARM
GHKELVKLLLEHKASPDSATTAGHTPLHIAAREGHVQTIRILLDAGAEQIKMTKKGFTPL
HVASKYGKVDVAELLLERGANPNAAGKVSHLTPLHVAVHHNNLDVVKLLVSKGGSAHSTA
RNGYTPLHIAAKQNQMEVASCLLQNGASPNSESLQGITPLHLASQEGRPDMVALLISKQA
NVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKF
LLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITSNGTSPLGIAKRLGY
ISVIDVLKLVTEESVSAITTEKHRMSFPETVDEILDVSEDEGDELLGMDGARYLKLDDFK
DQDDDFLSPKKTLRDFEGGMGTTPYSPAIPRIPCVSPETVMLDQHTPVPLPKEYDEDSLI
PSSPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCAAPTRIT
CRLVKPQKLSTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLR
SENGSVWKEHRNRYGDEVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRIQ
QESDLIGPEGGRLTSKLVPQVEAIFPETAVTKRVRLGLQAQPIPDELLTRQLGNQATFSP
VVTIEPRRRKFHRPIGLRIPLPPSWRESRRDAGEGDTTSLRLLCSVIGGTAPAQWEDITG
TTKLMYANNCANFTTNVSARFWLADCPRTAEVVTFANLLYRELMAVPYMAKFVIFAKMNE
AREGRLRCYCMTDDKMDKTLELHENFTEVARSRDIELMEGMPLYLECSGNLVPIRKATQQ
PRSFSFQAFRDNRLPVSVKVRDSNKDATGFLSFLRKGTKYEDTQHVLCNLNITMPPCVKV
VGSEERRRTLTPLALRERYSALNEPGVATVNAMERTELKINIISEQLGLSWAELARELQF
GVDDINRIRVENPNSLLDQSSALLSLWASREGKRAKMESLYIALKNIDRADIVTSLEGQA
PQPAPGSSEEGACRLGDRDSTLLSPSVINGYGLVQEELLSPASMQYSLPSPLGVEPYWQE
VSSLECAPIATTEEDTLMEMSDVQVWPAGVSPSLVTVEDSSLEGSSRADDSE
Download sequence
Identical sequences I3J835
ENSONIP00000005025 ENSONIP00000005025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]