SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005195 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005195
Domain Number 1 Region: 19-280
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-53
Family YWTD domain 0.00000272
Further Details:      
 
Domain Number 2 Region: 331-572
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000184
Further Details:      
 
Domain Number 3 Region: 632-893
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-50
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 4 Region: 941-1196
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-37
Family YWTD domain 0.0000607
Further Details:      
 
Domain Number 5 Region: 1327-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1249-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 7 Region: 897-944
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000283
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 285-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000796
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 588-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1207-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005195   Gene: ENSONIG00000004121   Transcript: ENSONIT00000005199
Sequence length 1623
Comment pep:known_by_projection scaffold:Orenil1.0:GL831206.1:2944662:2977893:1 gene:ENSONIG00000004121 transcript:ENSONIT00000005199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAVETTFGCSLRVSTAGSPLLLFANRRDVRLVDADGVRGESAIIVSDLEDAAAVDFLYSE
RLIFWTDVSEEAIKQTHWNQSSNCQTVVVSGLDSPDGLACDWLGKKLYWTDSETNRIEVA
NLDGTSRKVLFWMDLDQPRAIALNPGQRYMYWTDWGEEPRIERAGMDGSNRKVIVNEDIY
WPNGLTIDLVEQKLYWADAKLSFIHRANLDGSAPCSETVVEGTLTHPFALTLSEETLYWT
DWQTRSIHACSKHSGDKTREILSGIYSPMDIQVLEPYRQPDIQTPCSTDNGGCSHLCLLS
PVEPFYSCACPTGVQLKPDRKTCKPGAEQVLLLARRTDLRRISLDLPDFTDIVLQVDNIR
HAIAIDYDPVEGYVYWTDDEVRAIRRSSIDGSNATMLVTTEINHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTSRKILISENLEEPRAIVLDPVNGYMYWTDWGEHPKIERANLDGTA
RLVLVNSSLGWPNGLAIDYTAGKLYWGDAKTDKIEVISVDGSNRQTLLEDKLPHIFGFTL
LGDHIYWTDWQRRSIERVHKTTAVREIIIDQLPDLMGLKATKVTETFGTNGCAGDNGGCS
HLCFWRQQAVSCACPMGMELLSDLQTCVVPEAFLLFTNRDNIRSISLGTNSNDVVIPVTG
VKEASALDVYVYERRIYWTDIQAKTISRAYMNGSSVEHIIEFGLDYPEGMAVDWMGHNIY
WADTGTNRIEVARLDGQYRQVLVCKDLDNPRSLDNPRSLALDPANGYMYWTEWGGRPRIA
RAYMDGSTITTLVDKVGRANGLTIDYVDHRLYWTDLDTCMIESTNMQGLQREIIVDDLPH
PFGLTQYRDFIYWTDFNLRSIERADKRSGYNRTVVLQGQLELMLDILVFHSSRQDGTNEC
THNNGNCAHLCLATPAGAQCRCASHYTLNPDGRNCSSPSSFLLFSQKASISRMVLGEQSP
DIILPIHVMRNVRAVSYDPVERLVYWLDGRQNIRRARDDGAMSSMIVSSTAQPVDNQLHD
LSLDPYSRNIYWTCETTNTINVKRMDGHTVGVVIKDDTDKPRAIVVNAEKGYMYFTTVQE
RSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKLFWVDADLKRIESSDLTGANRIV
LQDSNILQPMGLTVLGDHLYWIDRQQQMIERVDKLTGDGRTRIQGRISYLTSIHAVEEID
PQEFASHPCSRDNGGCSHICIAKGDGTPRCSCPMHLVLLQDLLHCGEPPTCSTEQFTCST
GEIDCIPMAWRCDGFPECEDGSDEDNCPICSAYQFRCDKGGCIDAQRRCNGELDCADHSD
EQDCETICPPNQFRCGDNQCITKKQQCDNYSDCPDGSDELACAPSSGIPSTGPNTIGPVI
AIILLVFIIGGAYFVCQRVVCRRYKGPSGTFPHEYISGTPHVPLNFITPSGSQHGTYQGI
SCGKSMMSSVSLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAFYILNPPPSPATDRSLYN
TEIFYSSNSPSTTRSYRPYNPVRGTVPPTTPCSTDVCDSDYTPHHPPAGLGLSVGRWKGS
GHGSHTKHKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPSPSTERSYFHLCPPPPSPCT
DSS
Download sequence
Identical sequences I3J8K5
ENSONIP00000005195 ENSONIP00000005195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]