SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000005958 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000005958
Domain Number 1 Region: 5-225
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.96e-23
Family ADP-ribosylglycohydrolase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000005958   Gene: ENSONIG00000004731   Transcript: ENSONIT00000005962
Sequence length 279
Comment pep:known scaffold:Orenil1.0:GL831349.1:383348:388532:-1 gene:ENSONIG00000004731 transcript:ENSONIT00000005962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVADRATGAIIGAAVADAAAQPMHWIYDLDKLKAVLRDLEPCPEFRPQSANPFYRRT
TGEQTCYGDQAYVLLESLSRCGGVNVEDLTKRFHEFFGPGTVYDLPLNDPYRKKGGPKAI
LPINGPWRNASLKVFIRNVDAGKEETGCDVDCQIDGVTKIAPVVAMYAGRPEMLEKVEKA
IRVTQNNDMCVAVTLAAARFLEHFIVNGPDPNAVDAVLAQLNDPDRQNPQELDKAVIAHI
SQVKDNLTKTSQQLIPAVFTNTLDFARCVPGSASWSPDT
Download sequence
Identical sequences I3JAR8
ENSONIP00000005958 ENSONIP00000005958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]