SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000006388 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000006388
Domain Number 1 Region: 311-361
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000000346
Family Leucine zipper domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000006388
Domain Number - Region: 315-353,405-487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00388
Family Nucleotide and nucleoside kinases 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000006388   Gene: ENSONIG00000005080   Transcript: ENSONIT00000006393
Sequence length 713
Comment pep:known_by_projection scaffold:Orenil1.0:GL831484.1:156440:170439:-1 gene:ENSONIG00000005080 transcript:ENSONIT00000006393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDLLSDLDSRFFADNLLTSEDWDACLFQCESMEEGEDGDFGRGLKYDATFDNDLVLTL
DPDNPTSPWRHLDDNLLTADAPAIKNEMTITQPLPVEMLFQVKAEPPSPPSSLESECSAS
PPDPQITIKGENPPTPPYMYGDVLSPPLGSMEVTIATTAPPTQTQIAAVTQTQLQTPLTT
PIPAVIGGLQTQAAVLPSSATLKANTILSTKPPIQPRPVCVATLPVTQTATPAKALILQG
LPSMDQTRPVVISPSVCLGSTPAIVKMEPVSPSIPQHCSSPTAPPASKPIVPATTTLPGN
SSNDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRKENQALRE
RLAGKEGADSASNKRAVCVMVVLLFMTFSFGPVSITDRKLATGLQEDMVSFTGRRLLEIE
QRQQEAAPSTNKVEDKTETEEDVGDERWKRAEEKYAAESYQFRNLSDVFSDVKDLVLQDI
DRYFTSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGKPKIAKKAKIAQQKAQQRKTN
FSRYLPIQTHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNK
TSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPPPPP
PSSHSSSNHHHSNHTSLRGRHQHHPSSSSSSHRQPLPARRRTDEYLISQSEGV
Download sequence
Identical sequences I3JBZ8
ENSONIP00000006388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]