SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000007202 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000007202
Domain Number 1 Region: 29-427
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.84e-126
Family AAT-like 0.00000000000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000007202   Gene: ENSONIG00000005716   Transcript: ENSONIT00000007207
Sequence length 428
Comment pep:known_by_projection scaffold:Orenil1.0:GL831150.1:2370104:2378293:-1 gene:ENSONIG00000005716 transcript:ENSONIT00000007207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLKSSKVIYCLGNISPSLGVLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNL
GVGAYRDDQGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLK
SSRSVTVQTISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNHTPIFRDAGMQLKAYRYY
EPSTCGFDFKGALDDISKIPEQSIILLHACAHNPTGVDPRPEQWKEIADIVKKRNLLVFF
DMAYQGFASGDIDRDAWAVRHFIENGHNIVLSQSFAKNMGLYGERVGGFTVVCKDAEEAK
RVESQLKILIRPIYSNPPVNGARIAATILNTPELRSLWLEEVHGMANRIIKMREQLVAGL
KKNGSSHNWQHVIDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISMAGVTSGNVGYLA
DAIHAVTK
Download sequence
Identical sequences I3JEB1
XP_003442303.1.78416 ENSONIP00000007202 ENSONIP00000007202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]