SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009032 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009032
Domain Number 1 Region: 1-470
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-148
Family Pyridoxal-dependent decarboxylase 0.0000000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009032   Gene: ENSONIG00000007162   Transcript: ENSONIT00000009037
Sequence length 480
Comment pep:known_by_projection scaffold:Orenil1.0:GL831158.1:2302806:2327473:1 gene:ENSONIG00000007162 transcript:ENSONIT00000009037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEFRRRGKEMVDYVADYLENIEKRPVYPDLEPGYLRSLIPNEAPLEPESYEDIIKDV
ERVIMPGVTHWHSPYFFAYFPAASSYPAMVADMLCGAIGCIGFSWAASPACTELETVMLD
WLGKMLQLPECFIAGTHGRGGGVIQGTASEATLMSLLAARCKAVRRVQAINAKKSESEIL
SKLVAYTSDQAHSSVERAALIGAVMMRKVPTDNHYAVRKEMLKKMVEEDKAAGLIPFYFC
ATLGTTPSCAFDHLTELGPLCNEENMWMHIDAAYAGSAFVCPEFRPLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKERADIIGAFKMEPLYLKHENQESGLVTDYRHWQIPLGRRFRSL
KMWFVFRMYGLKGLQAHIRKQVALAKEFESLVRADKRFEICAEVVLGLVCFRLKGSNELN
QELLKRITKSREIHLVPCQLSGRFVLRFAICARSTESHHIQQAWQHITQLTFELLQEASH
Download sequence
Identical sequences I3JJI8
ENSONIP00000009032 XP_005450634.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]