SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009153 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009153
Domain Number 1 Region: 171-262
Classification Level Classification E-value
Superfamily TAFH domain-like 6.28e-29
Family TAFH domain-like 0.0000483
Further Details:      
 
Domain Number 2 Region: 540-588
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000343
Family TBP-associated factors, TAFs 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009153
Domain Number - Region: 415-490
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00719
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.01
Further Details:      
 
Domain Number - Region: 622-663
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.00889
Family Troponin T 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009153   Gene: ENSONIG00000007259   Transcript: ENSONIT00000009158
Sequence length 754
Comment pep:known_by_projection scaffold:Orenil1.0:GL831251.1:475015:483681:-1 gene:ENSONIG00000007259 transcript:ENSONIT00000009158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSATAQPVTPRLPQATSPHLPANIQIPPGMMLIRSDSGQLMLVSQQALAQAQQGQRLIC
GQPTRILAPQVSAGAESKRNENVTVIKMMPSSSFQQAAPVQKTAVVIGVASKPALVQTVN
VVSERGSHAGTQAAGVEVKKESAPTFSKVSPTRPSSHLHPQFDSAQQETIKQETLESVKK
CKNFLVTLIKLASSDSRSVNMANNVQGLVRSLLEGKLEAEAFTEQLYDTLKSTPQPCLVP
FLKKSLPAVRCLTADPQLFIQKASASTRPPTTTSSSIKQSNPEIGKTLQNRQQVTRCNIL
WGRGICNIHGGSQFNKKRKTTRGVALRPGLTTLIQSRSCISKKPTSRHIVGYSELTNQLI
FVPLVIVYFIVRVVDSKLLFCVCLNNCTHSLDASVCPRTVSGDLMKQPFAHEPPNSTKFA
FKDSSGSYNHETKCMKNSPAVYFLLQSGAVLVHTARPLHMYNLPSHRGGVFICGRILNSS
LTAAATFNHKHPQHKRVLCPREDDDINDVTSMAGVNLREENAQILTSTVGAVVQSCQDQL
FLSTQPVLSRILHTGQALGVTDVGPEVVALVSHATQEFLRGLLEKLTVMAEHRKTTLKQN
SWHTQVGDVRSQLRFLEAIETLEKKKRDEEERERVLRFARSRSHAEDPEYQQLKQKAKEL
QQIEEAQLQQREANLAALAAIGPRRKRPLDQTDSPERNSEDLLAKCCYSSATKVCVLPRP
GVRRVTRVILKDLLVCMEEEPFLRHSLTLYKAML
Download sequence
Identical sequences I3JJV9
ENSONIP00000009153 ENSONIP00000009153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]