SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009154 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009154
Domain Number 1 Region: 153-244
Classification Level Classification E-value
Superfamily TAFH domain-like 6.28e-29
Family TAFH domain-like 0.0000483
Further Details:      
 
Domain Number 2 Region: 538-586
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000343
Family TBP-associated factors, TAFs 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000009154
Domain Number - Region: 413-488
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00706
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.01
Further Details:      
 
Domain Number - Region: 620-661
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.00889
Family Troponin T 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009154   Gene: ENSONIG00000007259   Transcript: ENSONIT00000009159
Sequence length 752
Comment pep:known_by_projection scaffold:Orenil1.0:GL831251.1:475015:483681:-1 gene:ENSONIG00000007259 transcript:ENSONIT00000009159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSATAQPVTPRLPQATSPHLPANIQIPPGMMLIRSDSGQLMLVSQQALAQAQQGQRLIC
GQPTRILAPQVSHLCHCTSSKDAIISKVIGVASKPALVQTVNVVSERGSHAGTQAAGVEV
KKESAPTFSKVSPTRPSSHLHPQFDSAQQETIKQETLESVKKCKNFLVTLIKLASSDSRS
VNMANNVQGLVRSLLEGKLEAEAFTEQLYDTLKSTPQPCLVPFLKKSLPAVRCLTADPQL
FIQKASASTRPPTTTSSSIKQSNPEIGKTLQNRQQVTRCNILWGRGVNLTLIVPSHSFSL
CCKSGLTLMRMQVFQTRGVALRPGLTTLIQSRSCISKKPTSRHIVGYSELTNQLIFVPLV
IVYFIVRVVDSKLLFCVCLNNCTHSLDASVCPRTVSGDLSFSVKQPFAHEPPNSTKFAFK
DSSGSYNHETKCMKNSPAVYFLLQSGAVLVHTARPLHMYNLPSHRGGVFICGRILNSSLT
AAATFNHKHPQHKRVLCPREDDDINDVTSMAGVNLREENAQILTSTVGAVVQSCQDQLFL
STQPVLSRILHTGQALGVTDVGPEVVALVSHATQEFLRGLLEKLTVMAEHRKTTLKQNSW
HTQVGDVRSQLRFLEAIETLEKKKRDEEERERVLRFARSRSHAEDPEYQQLKQKAKELQQ
IEEAQLQQREANLAALAAIGPRRKRPLDQTDSPERNSEDLLAKCCYSSATKVCVLPRPGV
RRVTRVILKDLLVCMEEEPFLRHSLTLYKAML
Download sequence
Identical sequences I3JJW0
ENSONIP00000009154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]