SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000009734 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000009734
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.24e-40
Family GABA-aminotransferase-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000009734   Gene: ENSONIG00000007723   Transcript: ENSONIT00000009740
Sequence length 143
Comment pep:known_by_projection scaffold:Orenil1.0:GL831236.1:2125722:2128051:1 gene:ENSONIG00000007723 transcript:ENSONIT00000009740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWLWDVDGKRYLDLFAGVATVSVGHCHPKVTAATQRQLKKLWHTTNIYIHPELHEYCDK
LASYLPDPLKVIYLTNSGSEANELAMLMARLHTGNFDIITFRGSYHGGSQQTMGLTAKSS
CKFPIATSSGCIHVSTMTFLQFL
Download sequence
Identical sequences I3JLJ0
ENSONIP00000009734 ENSONIP00000009734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]