SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010135 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010135
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.89e-32
Family Putative zinc binding domain 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010135   Gene: ENSONIG00000008048   Transcript: ENSONIT00000010144
Sequence length 83
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:61534:68091:1 gene:ENSONIG00000008048 transcript:ENSONIT00000010144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRKSKRKPPPKKKMTGNLDTQFTCPFCNHEKSCDVKMERTRNTGIISCSVCLEEFQTP
ITYLSEPVDVYSDWIDACEAANQ
Download sequence
Identical sequences A0A087XBQ6 A0A2I4B973 I3JMP1 M4A2X5
ENSONIP00000010135 XP_003443110.1.78416 XP_004562948.1.88231 XP_005738145.1.53837 XP_005802844.1.87360 XP_005926809.1.24487 XP_006805098.1.46954 XP_006805099.1.46954 XP_007576595.1.10163 XP_008297419.1.38333 XP_008413564.1.1237 XP_012723365.1.37407 XP_012723366.1.37407 XP_013864299.1.33752 XP_014851986.1.96476 XP_014870808.1.100837 XP_015244964.1.42780 XP_015244965.1.42780 XP_017291145.1.84151 XP_017291146.1.84151 XP_018554117.1.34915 XP_019749082.1.30352 XP_019964763.1.63745 XP_020478702.1.23826 XP_020478703.1.23826 XP_020478705.1.23826 XP_020478706.1.23826 XP_020794393.1.12261 XP_022052138.1.10920 XP_022052139.1.10920 ENSXMAP00000008819 ENSXMAP00000008819 ENSPFOP00000003209 ENSONIP00000010135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]