SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010671 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010671
Domain Number 1 Region: 16-481
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.14e-182
Family GABA-aminotransferase-like 0.000000000000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010671   Gene: ENSONIG00000008491   Transcript: ENSONIT00000010680
Sequence length 485
Comment pep:known_by_projection scaffold:Orenil1.0:GL831154.1:3030866:3035335:1 gene:ENSONIG00000008491 transcript:ENSONIT00000010680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVMSLSNGHHVSKEEWESHNKMLLEPLAVNDSEVCAIIKKEKHRQTYGLELIASENFAS
RAVLEALGSCMNNKYSEGYPGQRYYGGTEHIDELERLCQKRALEAYSLDSEKWGVNVQPY
SGSPANFAVYTAVVEPHGRIMGLDLPDGGHLTHGFMTEKKKISATSIFFESMPYKVHPET
GYIDYDRLQENARLFHPKLIIAGTSCYSRNLDYARLKQIANENGAYLMGDMAHISGLVAA
GVVPSPFEHCDIVTTTTHKTLRGCRAGLIFYRKGVRSVDAKGKETLYNLESLINQAVFPG
LQGGPHNHAIAGVAVALKQAMTPEFKAYQLQVLANCKALSSALVDHGYKIVTGGSDNHLI
LLDLRSKGTDGGRAEKVLEACAIACNKNTCPGDKSALRPSGLRFGSPALTSRGLVENDFR
KVAEFIHRGIELTVEVQKSLDPKANLKEFVQALSQGEKFQQRVAEIRAEVEAFAGQFPMP
GLPEL
Download sequence
Identical sequences I3JP77
ENSONIP00000010671 ENSONIP00000010671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]