SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000010993 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000010993
Domain Number 1 Region: 27-463
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.92e-128
Family SepSecS-like 0.00000000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000010993   Gene: ENSONIG00000008744   Transcript: ENSONIT00000011002
Sequence length 485
Comment pep:known_by_projection scaffold:Orenil1.0:GL831490.1:6197:21411:-1 gene:ENSONIG00000008744 transcript:ENSONIT00000011002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDNFNLSEKIVSPSYIRQGSQARRGHEQLIRQLLEQGKCPEEGWSESTVELFLNELAV
MDSNNFLGNCGVGEREGRVASSLVARRHYRLIHGIGRSGDIAAIQPKAAGSSLLNKLTNS
VVLDVLKLAGVRSVASCFVVPMATGMSLTLCFLTLRHRRPKARYIIWPRIDQKSCFKSMI
TAGFEPVVVENVLEGDELRTDLEAVERKIEELGAENILCVHSTTSCFAPRVPDRLEELSC
LCSKHDIPHIVNNAYGVQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFDE
SFIQEISKMYPGRASASPSLDVLITLLTLGVSGYKKYLSERKEIYSFLAEQLKSLASAHG
ERLLHTPHNPISLAMSLDGLQANSDKAVTQLGSMLFTRQVSGARVIPLGKEQTVSGHTFR
GFMSHSDSYPCPYLNAASAVGITREDVTVCIKRLDKCLKTLKKEGGTAKNSSPVSSSNQE
VSIGE
Download sequence
Identical sequences I3JQ49
ENSONIP00000010993 ENSONIP00000010993 XP_005468232.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]