SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012099 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012099
Domain Number 1 Region: 7-382
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.45e-60
Family AAT-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012099   Gene: ENSONIG00000009630   Transcript: ENSONIT00000012108
Sequence length 391
Comment pep:novel scaffold:Orenil1.0:GL831134.1:4275975:4280931:1 gene:ENSONIG00000009630 transcript:ENSONIT00000012108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAQKELGRCVGGSVGSYSAAAGIPEIVHSISEFIKRRDGGIPSHPENIYISPGSQWSIS
NILNVLVNREASPRTGVLIPVPCHNKTVLSITQLGAVTVPYYLSEEQAWALQVEELQRAL
ESAKGVCSPVALYVINPGNPAGYVQSQKSVQEVIRFAWEKRLFLLVDELYQDCVYGENCE
FVSYKRTLSEMGPPFSGTVELASFHSVSKGFLGECGLRAGYVELVNLDPAVMKHIHTIFS
KDSCAPVLGQIALDLMTDPPKPGDPSYPLYKQEIEHIRAVLVHNVKRVHEVINSLPGFSC
PPLEGGLFAFPRLNLTPKAVQKAKELGLQPDTFYCTRLLEEGGVFTSPGWEYGQKEGTYH
IRFCIAAPQDIMEELLRRLSSFHMTFMKDFS
Download sequence
Identical sequences I3JTA4
ENSONIP00000012099 ENSONIP00000012099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]