SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000012399 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000012399
Domain Number 1 Region: 45-425
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.13e-103
Family Cystathionine synthase-like 0.0000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000012399   Gene: ENSONIG00000009868   Transcript: ENSONIT00000012408
Sequence length 430
Comment pep:known_by_projection scaffold:Orenil1.0:GL831134.1:6264882:6270228:-1 gene:ENSONIG00000009868 transcript:ENSONIT00000012408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQRALFSRGALLAQQTSAALEGPLGAKSAPVLLRLDRSMSSVTIPPPACMLRPLEVPLR
YLFGPGPSNVPPRILAAGSRPIIGHLHPEMYEIMNDIKKGIQYAFQTENNMTIAMSGSGH
AAMECAVFNTVEPGESVLIAINGIWGERVAEIAERMGANVHRMVKTPGRYFTNTEIEQAI
KKHKPVLLFLAHGESSAGLCHPVDGIGDICRKHDCLFLVDTVASLGAAPIFMDKQNIDIL
YSGSQKALNAPPGTAPISFNDRACHKMFNRKTKPVSYLFDMTHLSNYWGCDGKPARVYHH
TGPVSGFFALRESLAILAERGLEESWEKHKEVAAYLYRGLEDLGLKLFVPERDLRLPSVT
TIAIPEGYDWREMLTYIMKHHCIEMTGGLGPSIGMVMRIGLMGYNCEKTNADMALHALAD
ALKNCKKSKA
Download sequence
Identical sequences I3JU54
ENSONIP00000012399 XP_003438192.1.78416 ENSONIP00000012399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]