SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014217 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014217
Domain Number 1 Region: 7-418
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.69e-104
Family AAT-like 0.000000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014217   Gene: ENSONIG00000011295   Transcript: ENSONIT00000014227
Sequence length 424
Comment pep:known_by_projection scaffold:Orenil1.0:GL831211.1:3049633:3054319:1 gene:ENSONIG00000011295 transcript:ENSONIT00000014227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRLHARRTDGVDKNVWVEFTQLAADYKAVNLGQGFPDFSPPQFVQEAFCKAISGGPQM
HQYTRAFGHPPLVKSLAKFFSRIVGQDIDPLEDILVTVGAYQALFCAFQGLIDEGDEVII
IEPFFDCYQPMVVMAGGKAVYVPLRPQQREGSAILSSGDWVLSADELASKITPRTKAIVI
NTPNNPLGKVYKTEELQMIADLCIKHNLLCFSDEVYEWLTYDGAKHIKIASLPGMWERTV
TVGSAGKTFSATGWKVGWAIGSGNIIKYMKTIHQNSVYHCATAAQEAVAHGFEREYQLFG
TPESYFQQLPAMLHHKRKKLALCLESVGLQPIMPEGGYFMVTDISSVTEVDLNDPNTKDE
LYDFRFVKWLVKEKGLATIPVSAFYSPEHSKEFDKYIRFCFVKEDSTLDAAEAILRKWSA
DLIQ
Download sequence
Identical sequences I3JZC2
ENSONIP00000014217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]