SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014688 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014688
Domain Number 1 Region: 25-394
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.31e-62
Family AAT-like 0.000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014688   Gene: ENSONIG00000011667   Transcript: ENSONIT00000014700
Sequence length 398
Comment pep:known_by_projection scaffold:Orenil1.0:GL831253.1:325720:333279:-1 gene:ENSONIG00000011667 transcript:ENSONIT00000014700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGSSPDEKGVSQNGDPGGHRPVFTNTLNAAVSPETRLLSAFARDTQARKVDLAGREY
YSEEGRPFELRLVGKIKQQLSTDPTLHPEYPSSLGLREFTRKATEVALGKHSRAIVENRV
LGVQTPGFTAAVRLGAELLRCWYDPSACWCGPVYLSSPCDDSLTGIFQAAGIQEIPSAHY
PTGADLSQSQWAVITRLITRRRLFPFLLLPTQALCCGDMERDAWPVQHCASLGMELLCAQ
SFSHCFGLYGEAVGHLLCVLKQNSVLLPVRSQADKIVRSLWARPSVGGAHVVTTVLSNSA
HLVEWQGEVKHIVERCMLIRAILREKMRLLGTPGRWDHLTQQGGLFCCTGLNGEQVEFLS
NRRRVYLLPGGCLNVSAINCRNLDYIAESIHLALTSSL
Download sequence
Identical sequences I3K0P3
ENSONIP00000014688 ENSONIP00000014688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]