SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016322 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016322
Domain Number 1 Region: 23-438
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.52e-105
Family GABA-aminotransferase-like 0.00000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016322   Gene: ENSONIG00000012977   Transcript: ENSONIT00000016337
Sequence length 452
Comment pep:known_by_projection scaffold:Orenil1.0:GL831305.1:722958:727560:1 gene:ENSONIG00000012977 transcript:ENSONIT00000016337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEKLRKEETLAMRNRLIGQSCRLFYSEDPVKIVRARGQYLFDENGKRYLDCISNVQHV
GHCHPAITKAAAAQMDVLNTNSRFLHDNIVLYADRLAATLPQKLCVFYFVNSGSEANDLA
LRLARQYTQHEDVVVLDHAYHGHLMSLIDISPYKFRKLAGQKEWVHVAPLPDTYRGIYRE
DHPDPGQAYADTVKDLIEDVHKKGRKISAFFAESLPSVGGQIILPQEYFPKVAEYVRSAG
GVFVADEVQTGFGRVGHHFWAFQLQGDDFCPDIVTMGKPMGNGHPLACVATTAEIAGAFT
ANGVEYFNTFGGTPVSCAIGLAVLDVIVEEDLRGNAVRVGAHLKDLLTKLKARHEIIGDV
SRGVGLFLGIELVTDREKKTPATEAAAHVVKRLKEEDQICVSTDGPWENVLKFKPPMCFG
MENAELVVQCIDRILTDLERKTRCLTLLRINQ
Download sequence
Identical sequences I3K5C7
ENSONIP00000016322 ENSONIP00000016322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]