SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016358 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016358
Domain Number 1 Region: 5-423
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-82
Family AAT-like 0.00000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016358   Gene: ENSONIG00000013005   Transcript: ENSONIT00000016373
Sequence length 425
Comment pep:known_by_projection scaffold:Orenil1.0:GL831189.1:2973033:2981592:1 gene:ENSONIG00000013005 transcript:ENSONIT00000016373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYARFLTAVSAARKPSPIRMLTELQQRSPPSLISLAGGAPNPNTFPFQSASITVRNGQT
VTFDEVTMKRALQYSASNGIPELLTWMKNLQKNLHNPPTASYSPESGQMEMCVTTGSQEG
LCKVFEMLVNPGDNVLLDAPTYSGTLAALQPLGCNLINVPSDQHGMIPAALKEVLSRWHP
SEVHKPGSTAPKILYTIPNGGNPTGASMTAERKKEVYELARQYDMLIIEDDPYYFLQFEK
PWAPTFLSMDVDGRIIRTDSFSKILSSGLRIGFVTGPKPLVDRVVLHIQASTMHTSTFTQ
LMVSQLLHSWGQEGFLQHIDRVIEFYRKQRDAMISSADKWLKGLCTHQTPSAGMFLWMKL
KGIADTQQLIMEKALEKEVLLVPGGVFMINSSEPCPYVRAAFSLSTPEQIDEAFKRLSAL
IKEAL
Download sequence
Identical sequences I3K5G3
ENSONIP00000016358 ENSONIP00000016358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]