SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016784 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016784
Domain Number 1 Region: 407-810
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.68e-138
Family Ankyrin repeat 0.00000000000937
Further Details:      
 
Domain Number 2 Region: 111-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.75e-98
Family Ankyrin repeat 0.000000581
Further Details:      
 
Domain Number 3 Region: 1413-1496
Classification Level Classification E-value
Superfamily DEATH domain 1.01e-21
Family DEATH domain, DD 0.0041
Further Details:      
 
Domain Number 4 Region: 15-109
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.93e-20
Family Ankyrin repeat 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016784   Gene: ENSONIG00000013350   Transcript: ENSONIT00000016799
Sequence length 1906
Comment pep:known_by_projection scaffold:Orenil1.0:GL831238.1:853149:891249:1 gene:ENSONIG00000013350 transcript:ENSONIT00000016799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVKSVTFGADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNGLHLASKEGHVKM
VLELLHNGIVLETTTKKGNTALHIAALAGQEQVVQELVNYGANVNAQSQRQKGFTPLYMA
AQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALH
IAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKN
GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRIIEILLDHGAPI
NAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLL
DKGAKPNSRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLN
IVKILLQKGASPSASNVKVETPLHMASRAGHYEVAEFLLQNGAPVDAKAKDDQTPLHCAA
RMGHKELVKLLLEQKANPNSTTTAGHTPLHIAAREGHVQTVRILLDMEAQQTKMTKKGFT
PLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSA
ARNGYTALHIASKQNQVEVANSLLQYGASANAESLQGVTPLHLASQEGRPDMVSLLISKQ
ANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVK
FLLQQQANVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGAQPNETTTHGTSALAIAKRLG
YISVIDVLKLVTEETVSMTTTEKHRMSFPETVDEILDVSEDEGEELLGTEGARYMKMDDM
KDHDDDFLSPKKSLENYSPAIPRIPRVSPEPVILREHEIDQQHTPLPLPKEYDEDSLIPS
SPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCR
LVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVLRSE
NGSVWKEHRNRYGDEVLETILNGMDEDLESQEELGKKRIRRIISTDFPLYFAVVSRVQQE
SDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVV
TVEPRRRKFHRPIGLRIPLPPSWRESPRDSGEGDTTSLRLLCSVIGGTAPAQWEDITGTT
KLIYANECASFTTNVSARFWLADCPRTAEAVSFASLLYRELSAVPYMAKFVVFAKMNELR
EGRLRCYCMTDDKMDKTLEQHENFTEVARSRDIEVMEGMPLHLECSGNLVPVRKATQQPR
CFSFQAFRDNRLPVSVKVRDSSKEPTGFLSFLRKSTKYEDSQHVLCNLNIAMPPCIKIVG
SEDRRRTLTPLALRERYSALNEPAMASMSAMERTELKMAVIAEQLGLSWAELARELQLSV
DDINKIRVENPNSLLEQSSALLNLWATREGKRAKMESLYTALKSIDRMDIINMLEGQPPQ
PVRQGSRDLNRRRHSERDHLSPGMTNGYGLPQEELLSPASMQYSLPSPLGAEPYWQEVSS
LDCAPIATTEEDTLMEMSDVQVWPSGNSPSLVAVEDSSLECSNADDSEGLLGLPYGSLGR
PASQASAASGGGGVLSGSIELPEDDSEMGVDSLSTTTPASLGGTIAGINLNGLNNGQGSE
EGLSLVAGQQRVYARLSESTGLSSATDRNGDSKFLWCKQKRRTVPAESSQITWSESERGG
NRSLPRLLLPVARCGRCSPTYTLSWTTSLVKSREYPTKRRTSPPESSAVESFLRYKKTEV
HEFEGDEVEDLPGEQVSEEHFTDEHGNIVTKKIVRKVVRRGKGSGEEGFQEVSVEGSLQD
ANELDADAEQFMSYAVLGRDSSKPDTVDVKKGAQIVKCASLRRVKQ
Download sequence
Identical sequences I3K6N9
ENSONIP00000016784 ENSONIP00000016784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]