SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019616 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019616
Domain Number 1 Region: 6-222
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.57e-21
Family ADP-ribosylglycohydrolase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019616   Gene: ENSONIG00000015590   Transcript: ENSONIT00000019633
Sequence length 258
Comment pep:novel scaffold:Orenil1.0:GL831380.1:465228:467840:1 gene:ENSONIG00000015590 transcript:ENSONIT00000019633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALANRAIGAIVGSAVADAAAQPLHWVYDLQKLKGILALNPNPEFHPESANPFYRRET
GKQSCYGDQAYVLLESLSECGGLNVDDLKQRTLKVFGPGSEYDTPVNDPYRERGGPRPQL
PIDGPWRHASLKSFLKNVDAGKEETGCENDCQIDGIAKLAPIVAFYAGQPDMLEKVEQAI
RVTQNNDECVAETLAAARFLEHFILNGPDPKALDAVLNQLNDPNRKQPQDLDKAVIGHIH
QVKENLSKTPQKLIPSVF
Download sequence
Identical sequences I3KES1
ENSONIP00000019616 ENSONIP00000019616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]