SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019798 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019798
Domain Number 1 Region: 972-1082
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-24
Family PDZ domain 0.0000414
Further Details:      
 
Domain Number 2 Region: 38-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 244-343
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.56e-23
Family Ras-binding domain, RBD 0.00000607
Further Details:      
 
Domain Number 4 Region: 394-495
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.03e-20
Family FHA domain 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019798   Gene: ENSONIG00000015733   Transcript: ENSONIT00000019815
Sequence length 1829
Comment pep:known_by_projection scaffold:Orenil1.0:GL831352.1:421187:500430:1 gene:ENSONIG00000015733 transcript:ENSONIT00000019815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVGGRKVHKKLACELFCWHADRKDICGLGDPQKDLEFHGVMRFYFQDRVAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNKD
DREGRFVLKNENDILPKKSQSNGPEKEKDGVIQNFKRTLSKKEKKKEKKREKEFARIPDG
DDQTLSREDGFRDNLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFMSSDGR
PDSGGTLRIYADSLKPNIPYKTILLSTRDTADFAVVEALEKYGLEKENPKEYCIARVRFP
PSAHQDDKSGKEVILDDYECPLQIFRDWPADRGALVFQLKKRPPDYQGRKGRKGDDKGLR
GKDSSLPPEKLPYLVELSPGLPACLGRGNHYAYYAYRHHEDGSDSRDKPKLYRLQHSITE
VGSDCTDDGAIQLLGPGILPHHCNLMHSEGMVTVTPHGPDADTFVDGQRIIETTMLRSGS
TIQFGSAHVFKFVDPMFDQGGKREPAIPRSRHKSGSVPETTFDLHGDVHSGGALPTSKCT
ASVVDSPFKSSGKLDMERGMVKPMIRGEQQDSRSQDVSADRTELTLPASIEFRDNSEDTF
LSAIINYTNSSTVHFKLSPTYVLYMACRYVLSPTYRLDMSPSERTHKVIAIVNKMVSMME
GVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDILAHLVQMAFKYLVHCLQ
ADLNNYMPAFLDDPEEHNPQRPKIEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFIN
MWLFNKLVTDTGSGLCCHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTM
DKYSMQDVQTINNTCFKLNSLQLHALMTNYHCAPDEPYIPPELIDHVVAVAENTADELAR
SDGREVQLEEDPDLQLPFLLPEDGYSCDVVRSLPNGLQDFLEPLLQRGFCRLTPHPRSPG
TWTVHFEGADCDSHFSAADNSEMIKPMRKEPEVVTVTLKKHNGMGLSIVAAKGAGQEKLG
IYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGA
IYHGLATLLNQPSPMMPRASDRGREKNGKMRPKSEGFELYNSSVQNGSPESPQPGWDSYP
EPKKMSGEDRLLKNRADHRSSPNVANQGQSPANKSVYPGGPGTKITSVSTGNLCADDEPS
PPRPEAYPIPTQTYPREYFTIPASKSQDRVVGPGQQGPPPHWQGMEDRDRLPMGDNIHNN
SMQRINHSQEDLYPPPGSMRPDERMQPHYQHRDRPDHWAPQPQVSSSLESSTSSQEHLNF
SASSSSSNKTQNQKTGPGRWKTPNAPHAVPPHSAQPPSRSDLPPPPPPPPAAYPEPYDPQ
SDLPLPPPPAAINPVTAQQAADRKKREEQQRWYEKEKARLEEERERKRREQERKLGQIRA
NPVMPVPYHPPQPQPPPPRPEKLASLPRCMDTVIRELLPQQQPRTIERRDLQYITISKEE
LTSSDSLSPDPWKRDAREKAEKQQQLHIVDLLDKEIQELQAKPERTAEENDRLRKLMLEW
QFQKRLQESKQSDDEEDEEDDEDVDTVMIMQRLEAEKRARLQDEERRRKQQLEEIRKREA
EERAKQEEERRWREEERAKREAEEKRRQEEEYYARLEAERRRQHEEAERKLLTPDEPAGL
YRPPLPRDYQPPAPQNPTNNPPPPPQRNTSYLKTQVTSPDTLYTAKFVTYTGDDEDEEEA
TKAGSGGGQSGFNSYTGNSSGVVGTGEVYKDPRDKWTRSQEQENSIPSDAPESLTFKERQ
RLFSQGKEVSNKVKASRKLMELENELNTK
Download sequence
Identical sequences I3KFA3
ENSONIP00000019798 ENSONIP00000019798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]