SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019927 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019927
Domain Number 1 Region: 61-418
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-108
Family AAT-like 0.000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019927   Gene: ENSONIG00000015831   Transcript: ENSONIT00000019944
Sequence length 428
Comment pep:known_by_projection scaffold:Orenil1.0:GL831148.1:246629:251598:1 gene:ENSONIG00000015831 transcript:ENSONIT00000019944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKTSSCRLLFKFIHQGAVAPLAGLNALRSVLGWSSTRGYYNSGKPSYAGPGGAAHVRV
VDLRSDTVTKPGPAMRQAMAEAKVGDDVMGEDPTVNELQKIAADMFGMEAALFVPSGTMS
NLIAVMVHCRERGDEVIVGDSSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDLEQLESKI
RHGYPDPHYPRSRLVCVENTHNIQGGRVLPLAFLQEVRALADRYGLSVHMDGARIMNAAV
AQGVPPSAILQHTDTVSVCLSKGLGAPVGTVLAGPQDFISRAVRCRKALGGGMRQAGILA
AAGKLSLQNMIGRLEEDHRNAKTFAQALLDCNPNLFAVDLAAVETNILRFRLQDLSLSPR
EFCDRMAQVSKSEEAALGQGIQVLMYPHFGNSVRAVWHLGISPEDTQLAIQKMQFVVSQH
VMENIRAQ
Download sequence
Identical sequences I3KFN2
ENSONIP00000019927 ENSONIP00000019927 XP_003441921.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]