SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020771 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020771
Domain Number 1 Region: 10-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-20
Family G proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020771   Gene: ENSONIG00000016496   Transcript: ENSONIT00000020790
Sequence length 218
Comment pep:known_by_projection scaffold:Orenil1.0:GL831373.1:766874:768357:1 gene:ENSONIG00000016496 transcript:ENSONIT00000020790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDTGKHTSTTVNLVLLGMAGAGKSASGNTILGKKVFMSKPSSKPVTRECQVEETNIYGIH
LRVIDTPDIFDEELESSDKEKRVKSCKELCESETCVYVLVIHVSRFTDGERDILKKLEKA
FGNNVSEQTVIVFTKGGDLQQAEMSLEDFLNSCQPKLKEIIEKCGNRCVVFENSKSDSDQ
VKKLIDVIRIMNLVSYCVNFISNYSVLKQRSTSKCLFE
Download sequence
Identical sequences I3KI26
ENSONIP00000020771 ENSONIP00000020771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]