SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021300 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000021300
Domain Number - Region: 102-195
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0523
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021300   Gene: ENSONIG00000016893   Transcript: ENSONIT00000021319
Sequence length 254
Comment pep:known_by_projection scaffold:Orenil1.0:GL831325.1:1047860:1052865:-1 gene:ENSONIG00000016893 transcript:ENSONIT00000021319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQSSDILGHERPLVIRVSFATCVLATVCLPLLGLITCVFISSVFHFEDATGTHCQVPNY
LPSISASISLSPECHIWRFCIGLHSAPRLLVAFTYFKFYKARFATRFPESSLSCLNLGFS
ISENLGLLLLTYVSSTETYFVHKEGFVLFIVSSLIYMLITCRLWKSIKKYSLNPEDAKSH
HWKVRFLLLNVSFCAFAGFFYWKHNMYCESGSYTFFALFEYLVVFSNMAFHLTAVWDFKS
REVMLISSSEDKDF
Download sequence
Identical sequences I3KJK5
ENSONIP00000021300 XP_003455981.1.78416 ENSONIP00000021300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]