SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021434 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021434
Domain Number 1 Region: 52-414
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.22e-113
Family GABA-aminotransferase-like 0.0000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021434   Gene: ENSONIG00000016998   Transcript: ENSONIT00000021453
Sequence length 416
Comment pep:known_by_projection scaffold:Orenil1.0:GL831307.1:1441745:1447864:-1 gene:ENSONIG00000016998 transcript:ENSONIT00000021453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLASKPTSAGGGEQRHGRNSGFHSAESGRDSRQGQHPPAGVSSVLYIMEHKQTINFGAG
PAKLPPSVLLQAQNELLNYSGTGISVLEMSHRSSDFNKIINKTESLLRELLNIPDNYKVL
FLQGGGSGQFSSVPLNLIGLKEDRCADYLVTGTWSAKAAKEAEKYGKVNVVHPKLDSYTK
IPDPSSWTLNPSASYVYYCSNETVHGVEYNFTPETNGVVLVSDMSSNFLSRPVDVSKFGL
IFAGAQKNVGCAGVTVVIVREDLLGHALKECPIVLDYKVQAEMNSLYNTPPCFSIYIMSL
VLEWIKNNGGSAAMEMLNKQKSSMIYDIINASNGFYVCPVDTACRSRMNVPFRVGKKEGN
EALEKEFLDGASKRGMISLKGHRSVGGIRASLYNAVTLEDTKALAEYMKEFVKEHQ
Download sequence
Identical sequences I3KJY9
XP_003455353.2.78416 ENSONIP00000021434 ENSONIP00000021434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]