SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021547 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021547
Domain Number 1 Region: 420-687
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000294
Family Tropomyosin 0.00063
Further Details:      
 
Domain Number 2 Region: 1831-2102
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000523
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 3 Region: 281-440
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000327
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021547
Domain Number - Region: 1734-1846
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000811
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number - Region: 1271-1375
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000915
Family Myosin rod fragments 0.0018
Further Details:      
 
Domain Number - Region: 18-129
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0107
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number - Region: 2323-2436
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.0023
Further Details:      
 
Domain Number - Region: 1371-1484
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.0026
Further Details:      
 
Domain Number - Region: 1133-1227
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021547   Gene: ENSONIG00000017088   Transcript: ENSONIT00000021566
Sequence length 2837
Comment pep:known_by_projection scaffold:Orenil1.0:GL831287.1:585030:606608:1 gene:ENSONIG00000017088 transcript:ENSONIT00000021566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWAVEEWKDGLPGKALQKIQEMEVQLDKMKKEKTQKQFQLDSLEAALQKQKQKVDSERT
ETSALKRENQSLVESCDSLEKARQKVVHDLGVKEQQVSYLEGQLNSCRKTIERLEQELKK
HKNELDRSQPAGSSSLSSSSCELQTYATPQKSFQTPASIPAYRQHDNRLEELQEKYNQEV
EERKRLESELKVFQVKLLNQSSVSVSHKDIAARQAGSSIFPWQQQDSAHCRQSQDIMETP
LKRRGTSLWDAHEETPIKPSQRMSSSRAAPSPSGSSQQMEQLKTLNQELRGRVSELERNL
ANQEKEIRNQASKLQELQTQLNQTRKDLSEQGRDLAKTKHELSQATDRHQQIESKCSSLE
QKLKQVTEEMSCQRHNAESCRRALEQKLKDQERDSQKELAQLQSSHHALDQQLNQTRTKL
TQEIQQAKKDHNILQADMEKMCFQKKQMEKEMEEQKQKLLRSEQSLQACQTKEQDLRKKM
EELQKEKNSMTVQLDQSNRRLSQLEEEKKSSDQSLKRTQGLLDDLKAKSEGQVEELKKLQ
CKLEQQTQTSAREQENFKKTLSDAETRNDRSQNELQKQKQESERLSNRVTVLEKESQELK
SNFSASQNECKELKREHQALLDWKNEKETLINETEAVQKELTDKITSLESSLGSLNEAND
ELQKKLTCVEGEKASLSAHIDSLKGELLNKCTDLEEKAHQYKELQSQFSEAGQKHAKDLE
NIGVQVAQLEAQVKDLELRLQKEITRAELAERMNTDLQDEHKATCDLVSSKEQLVELGRA
EISQLRESLAQTIAQQEEQNARLAEEKAALLKQCEESVSAKAEETEHIKLQLEEAQQELL
LTKNQISSLEQLLKVQEQLGAELQKQIKAMTEREEEQTRMYEKKSEELKQLEMDLSDQRK
QTEEKEKQLREAEVQISSVEKQKAELENAIQDLKKEAEIIQHSQTEKINSLLEQISSLEE
KVDVNKDAAEKLPVLKNELDVATQSNADLKKSLEALEKNHSSTIEMKSNLESTLAEKMNL
ISALENEVKDLTEKMGKESERHALEIENFLKKEKSLDEQLEATKKSVSAAKAESSSRREE
IRTMKATLSAASRGLEERDNTIKGLKEKLNKAEAEQTKTSELLKEKVVAMNKIKVQLEML
QMDLEDNETAMTSFDSQVEQLKGTIESLEAMLAQNQTQMSEMEAMLDEGRAQVSVLEARL
DEVQSQNSLLESKYVTAKEELFERTCEITRLEEEAIRRHELEESVATLEAKLSHMTQDNE
KLETTLRETIQDKERSLNQLLQEKNSLETSMKQLMNDKEQVESEMVHVNAEKKRLEVTVD
ALSEENKQLQSNIERLTEEKQQTEAKINEITARKHEAGSALSQLTEAKAQVDDILKKTNE
ENVQLAEKLHASTSEKNDLVTNLNQVVEEKVQLELSYNQLSEENIKLQSSVNQITEKKLQ
LQELIKGHGDEVASLREENECIQHSLLTSEQECQRLKEQLELMEERTEETNKEQGERFTA
EQAELHQKLAGLQKELSVFKQQYESLLEQVGQQHSLIQQLSEFKSPTDRNSHMEEAETDA
EAAAESQVEPAGNSSLCTSSETLPVEEELMVSEPTEFPDAFSEAKLVFKVDATEQEVTQE
QPEEGGEAFVADVEETKTNEEEQLLPEQVSEESSNSRDVLVDEPVIYDVSPQPSSFSEKR
DMKSCESSLVNDELERYKEMIRKQENELETLRSEFDLLSSDLELRKELTSELEVQVQNLE
KKVHAAEEEAHSAACQLKIALDSKKSLSDELTQLSEEKETLTLQLQTTKCQLTDVMEMLE
GLEMAKGGWDEKFLQQESELKRVRSEKANLEQHILGMESELETMQAEGARLKDEMETQRR
IFSGMEQKIETLITETTQLRSELVSCTEERDELSQSLSHWREKVHSLEKNNCDTRNLISI
LEDDIRAGRKEYEALQSSTDKLKTERQQLVEQVKELEQTISQHCGEREELIGHLNQIKED
HSSSSQNTESMAGKIKALEGEVIRLSQSLESSLLEKGEIASRLNSTQDEVQQMRTGIEKL
QVRIESDERKKKKMGELLKAAQRKSDSLQDRIDSLEREKEDVEQSLEEAVLQTEMAKAEL
EEERRMVEEEKKELSAKISELSTTLENLRSEKEHMERQLEIKNREIEELKAAKEELERGL
EKAEAERKEEEERQKCRLEELEKEMKGEAERQIRVLDDLQAQLEASRQREISLEQKSTEE
EAEKERMQALLVQLEEEKKHLLNSLQESQTEAERLRTHGEEWETERNSLRTQTEALEEEI
EELKTLIKATEDKMEVLEKEKEEDRDQKQALERSVSSLIAEKEQIEGENGRFLQEKEELR
TALLSLEQERDKLRSSLLSVEEEKERLDQERSALASEREELQSSLSVLDKEKHDLQQKLS
FLNQEKAREEEEKQKIEAEKQELQSSVSLMEEEKKNLSSALLSLEQEKEKLAEEHEHLKT
AVSSMEKELETHKVSVSQLSEQVSELTSRAARLTKDKDSALSKMSLWMKTCKQLEQEKEM
MLNGSGAGKSSEEGQTELTQLRKEAEKLKKEVEDLKSALEQKMSEAEERLMESQEKDQEV
NKLSAALDGKRKELEETVKELEEMKTDLEEVNKLLEEKSKEADESMEKYCSLMLEVHKLE
KTNEALKTRLELIGASQNANDGHSSSTEGRQRSGRKSSTRHQELKIDDNTENMAPSSTQR
SPPGSGKRGHREISNRDGAQEALHNVTKRIKANAMTTPKSRPEQEDEEFRPEGLPELVQR
GFADIPLGEASPFIIRRTTVRRCSPRLAAKQTASDGKGLGPIPLQSPSAAMATDTANKTP
EKQLREQTQQGDNCHVQ
Download sequence
Identical sequences I3KKA2
XP_005459003.1.78416 XP_005459004.1.78416 ENSONIP00000021547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]