SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021591 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021591
Domain Number 1 Region: 396-489
Classification Level Classification E-value
Superfamily TAFH domain-like 1.1e-34
Family TAFH domain-like 0.00000625
Further Details:      
 
Domain Number 2 Region: 671-718
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000816
Family TBP-associated factors, TAFs 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021591   Gene: ENSONIG00000017122   Transcript: ENSONIT00000021610
Sequence length 884
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:6354463:6367659:-1 gene:ENSONIG00000017122 transcript:ENSONIT00000021610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGAAGITSTAGPSVTATQSQSKSDAASGVVTVTLDATAGAGKPGGTGAQTLNGSAVVMN
CQITAGGPADSNNSQPGAVTLLNNGPVSVSKPSAAGLPGTPSTIIRATLNAQNVVTSSVI
SSQPSVKTVPTVTLVRPPMQTSMNPSPSTGSPTTVLTSPSVSVTSTTGSPASKTDCPKAI
MPTGAHVVASVVATGTTATVRSPTVLQGLRTSVPSTVAATPPGGIRTIVPQVLAPRLAQP
QQNAPNIQNIQLPPGMVLVRSESGQLLMIPQQALAQMQAQSQSQSAMTPRPPAPTSTPPV
QITSLQAPGAPLLARPVTPTTIIKQCSTVQTTVTATTALQRPPVLQNTIMLGGVATTAGQ
PLGTATMVQPGSASTAVAQRVGPVGATATPVTPTPVTAETLENVKKCRNFLSTLIKLASS
GKQSSETTANVKELVKNLLEAKIEPEDFTSRLYQELNSSPQPYLVPFLKRSLPALRQMTP
DSEAFIQQSLLPQLSPQPTAAASTALTAVVLRPPLSTAITTTTSPATTKTTVISLTQTPH
SKPGLIVPQQQGTIVRPPVTLAQSAVVTLRGQTHSRIIVSQPQVIKQLQTIPAVKQTLAP
APKGIQVFSQPSFGTAQKNKLKEGGTFRDDDDINDVASMAGVNLSEESARILATNSELVG
MVTRSCKDETFLSTSLLTRIVLEIGKKFSVSELGTDVINYISHATQQRLQDVLEKVSQVA
QQKNLTFKEDERYEQASDVRTQLKFFEQLDQMEKQRKEEQEREILLKAAKSRSRQEDPEQ
LRLKQKAKEMQQQELAQIRQREANLTALAAIGPRKKRKMDSPGRGANAEGSGSCPSQTGG
SGGTGSRQFMRQRITRVNLRDLLFCLENERGTSHSHLLYKGFLK
Download sequence
Identical sequences I3KKE6
ENSONIP00000021591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]