SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021592 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021592
Domain Number 1 Region: 507-600
Classification Level Classification E-value
Superfamily TAFH domain-like 1.29e-34
Family TAFH domain-like 0.00000625
Further Details:      
 
Domain Number 2 Region: 789-836
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000963
Family TBP-associated factors, TAFs 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021592   Gene: ENSONIG00000017122   Transcript: ENSONIT00000021611
Sequence length 1002
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:6357021:6368057:-1 gene:ENSONIG00000017122 transcript:ENSONIT00000021611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLGDVFLSTEVDEKVVSDLVGSLESELTETRCDNTTARAPSAENHGGNSAVGSS
LNVQGSKMGLSQQELAKAGKIAAHSGVSAAAGTGAQGGVSNSTGSLGSSMDGAAGITSTA
GPSVTATQSQSKSDAASGVVTVTLDATAGAGKPGGTGAQTLNGSAVVMNCQITAGGPADS
NNSQPGAVTLLNNGPVSVSKPSAAGLPGTPSTIIRATLNAQNVVTSSVISSQPSVKTVPT
VTLVRPPMQTSMNPSPSTGSPTTVLTSPSVSVTSTTGSPASKTDCPKAIMPTGAHVVASV
VATGTTATVRSPTVLQGLRTSVPSTVAATPPGGIRTIVPQVLAPRLAQPQQNAPNIQNIQ
LPPGTGMVLVRSESGQLLMIPQQALAQMQAQSQSQSAMTPRPPAPTSTPPVQITSLQAPG
APLLARPVTPTTIIKQCSTVQTTVTATTALQRPPVLQNTIMLGGVATTAGQPLGTATMVQ
PGSASTAVAQRVGPVGATATPVTPTPVTAETLENVKKCRNFLSTLIKLASSGKQSSETTA
NVKELVKNLLEAKIEPEDFTSRLYQELNSSPQPYLVPFLKRSLPALRQMTPDSEAFIQQS
LLPQLSPQPTAAASTALTAVVLRPPLSTAITTTTSPATTKTTVISLTQTPHSKPGLSFSE
CAQIVPQQQGTIVRPPVTLAQSAVVTLRGQTHSRIIVSQPQVIKQLQTIPAVKQTLAPAP
KGIQVFSQPSFGTAQKNKLKEGGTFRDDDDINDVASMAGVNLSEESARILATNSELVGMV
TRSCKDETFLSTSLLTRIVLEIGKKFSVSELGTDVINYISHATQQRLQDVLEKVSQVAQQ
KNLTFKEDERYEQASDVRTQLKFFEQLDQMEKQRKEEQEREILLKAAKSRSRQEDPEQLR
LKQKAKEMQQQELAQIRQREANLTALAAIGPRKKRKMDSPGRGANAEGSGSCPSQTGGSG
GTGSRQFMRQRITRVNLRDLLFCLENERGTSHSHLLYKGFLK
Download sequence
Identical sequences I3KKE7
ENSONIP00000021592 ENSONIP00000021592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]