SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022974 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022974
Domain Number 1 Region: 263-356
Classification Level Classification E-value
Superfamily TAFH domain-like 1.29e-34
Family TAFH domain-like 0.0000458
Further Details:      
 
Domain Number 2 Region: 613-661
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000053
Family TBP-associated factors, TAFs 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022974   Gene: ENSONIG00000018242   Transcript: ENSONIT00000022994
Sequence length 823
Comment pep:known_by_projection scaffold:Orenil1.0:GL831424.1:491660:505789:-1 gene:ENSONIG00000018242 transcript:ENSONIT00000022994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTKVLVPSQPATGSSVILTGTPPPVQAPISHPQTGTSTSPSAGAKPAVNGVSQPAVAVV
RPPVPAVVATSIPQQRPGLVAATTRVATSQPSLAVRPQQQTTIQLPQGFTMPQGMVLVRT
ETGQLVMVPQQVLAQAQAKTQQSQAVTSITQRPATPTAGATIRVCVSYNSQGQIAKRLAV
SLIKPLAIMAACDIQALQKALAVAPGVTPVSVKMTTPQKTPTVITTGGTPVAKPAGVPST
PMTGTPAPAASAAARVTVVSQEMQENVKKCKNFLATLIKLASHNSPSPDTSKNVKALVQD
LLDAKIEPEEFTTRLQAELKSSPQPYLIPFLKKSLPALRQTLLNSQQSLMTAPPSAVVTP
PATPGSVTATTIRPRLPVSPAGGTVRLNAPIGTAALVRIVRSEKNTSTANLHQTRLFGVS
VLTGALRVTVSRPLAVTKQANAEPSEEPVCRPGVQTVQTRAPIVFRPQATLQVRGPTTII
SKSPVNLAAQANQKKLSDPGGGTFRGVVMTRLYKQRCYSDTAGAPTGKRLVTTSCWTCSS
QMRQEGAVCAHGTASKEKDKQEVTSSFARRDDDDINDVASMAGVNLNEENARILATSSEL
VGTKIRSCKDESFLPSGLLLRRILDTAKKFGVSEVPPEVVNLVSHATQSRLRTLLEKVSA
IAQHRTDGGKDEERYEQTSDVRSQLRFFEQLERLEKQRKDEQEREMLLKAAKSRARQEDP
EQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKLDSPGGAGTEVSSGSAAGPS
VAGSSRQQPRQRITRVNLRDLIFCMEHDRPTARSLILYKALLK
Download sequence
Identical sequences I3KPC9
ENSONIP00000022974 ENSONIP00000022974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]