SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023097 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023097
Domain Number 1 Region: 4-410
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.03e-125
Family AAT-like 0.0000000000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023097   Gene: ENSONIG00000018342   Transcript: ENSONIT00000023117
Sequence length 413
Comment pep:known_by_projection scaffold:Orenil1.0:GL831242.1:250212:254077:-1 gene:ENSONIG00000018342 transcript:ENSONIT00000023117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLKMSLFSEVPQAAPVAVFKLTQDFNNDQFPNKVNLGVGAYRTDEGQPWVLPVVKKVEKI
IVHDDRLNHEYLPILGLPEFRSSASKIVLGDNSPAILENRVGAVQCLGGTGALKIGAEFL
RRFYNGSNNTKTPIYVSAPTWENHNAVFSSAGFEDVRPYRYWDAEKRGLDLAGFLGDLES
CPEHSVFVLHACAHNPTGTDPTQEQWKQIAEVMMRRKLFAFFDSAYQGFASGSLEKDAWA
VRYFVSSGFEMFCAQSFSKNFGLYNERVGNLTVVARDADNLKRVLSQMEKVVRITWSNPP
SQGARIVTITLTSPELFSEWQENVKTMANRVLLMRSQLKAKLQALGTPGTWDHITDQIGM
FSFTGLNPKQVEYLVKEKHIYLMASGRINMCGLTTKNIDYVAESIHEAVTKVQ
Download sequence
Identical sequences I3KPQ2
ENSONIP00000023097 ENSONIP00000023097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]