SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024256 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024256
Domain Number 1 Region: 542-667
Classification Level Classification E-value
Superfamily PH domain-like 8.89e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 83-302
Classification Level Classification E-value
Superfamily ARM repeat 0.000000045
Family HspBP1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024256   Gene: ENSONIG00000019274   Transcript: ENSONIT00000024277
Sequence length 721
Comment pep:novel scaffold:Orenil1.0:GL831146.1:4122003:4150324:1 gene:ENSONIG00000019274 transcript:ENSONIT00000024277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPSDIVKVAIEWPGANAQLIEMDQKRPLSSIIREVCDGWSLSGSEQFALRYADGPQLY
ITEQSRGDIKNGTILRLAISPTRAARQLLERIQSHGIDARLEALKELAKLSADPTFAAEF
INMEGIGTLARLVESGTHFGEMLAFTLTAFLELMDHGIVSWDLISLSFIKQIAGYVNQPM
VDVSILQRSLAILESMVLNSHSLYHRVAQEITVGQLIGHLSNQEIQTYAIALINALFLKA
PEDRRQEEYTNPLEQHLTEMASSLAQKHLRSIILNHVIRGNRPIKAEMAHQLYVLQVLTF
NLLEERMMTKMDPNDQAQRDIIFELRRIAFDGENDPTGTEKRKAMYTKDYKMLGFTNHVN
PAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRCAIELTRMLCE
ILQVGELPNEGCNDYHPMFFTHDRAWEEFFCVCIQLLNKTWKEMRATAEDFNKVMQVVRE
QITRALAMKPSSIDQLKTKLRGLNYSEILRLRQSERMSQDDFQSPPIIELRERIQPEILE
LIKQQRLNRLCEGSCFRKLGNRRRQEKFWFCRLSLNHKVLHYGDLDESPQGEVPFELLSD
KIPVSDIKSVVTGKDCPHMKEKSALKQNKEVLELAFSVLYDPDETLNFVAPNKYEYCIWT
DGLCALLGREMGSDLTRSDLDTLISMEMKLRLLDLENITIPEAPPPVPKEPSSYNFTYNY
S
Download sequence
Identical sequences I3KT10
XP_019214349.1.78416 ENSONIP00000024256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]