SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024257 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024257
Domain Number 1 Region: 544-669
Classification Level Classification E-value
Superfamily PH domain-like 8.42e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 85-275
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000975
Family HspBP1 domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024257   Gene: ENSONIG00000019274   Transcript: ENSONIT00000024278
Sequence length 723
Comment pep:novel scaffold:Orenil1.0:GL831146.1:4128070:4145912:1 gene:ENSONIG00000019274 transcript:ENSONIT00000024278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPSDIVKVAIEWPGANAQLIEMDQKRPLSSIIREVCDGWSLSGSEQFALRYADGPQLY
ITEQSRGDIKNGTILRLAISPTRAARQLLERIQSHGIDARLEALKELAKLSADPTFAAEF
INMEGIGTLARLVESGTHWYQYWFYFVVFIFGEMLAFTLTAFLELMDHGIVSWDLISLSF
IKQIAGYVNQPMVDVSILQRSLAILESMVLNSHSLYHRVAQEITVGQLIGHLQVSNQEIQ
TYAIALINALFLKAPEDRRQEMASSLAQKHLRSIILNHVIRGNRPIKAEMAHQLYVLQVL
TFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDGENDPTGTEKRKAMYTKDYKMLGFTNH
VNPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRCAIELTRML
CEILQVGELPNEGCNDYHPMFFTHDRAWEEFFCVCIQLLNKTWKEMRATAEDFNKVMQVV
REQITRALAMKPSSIDQLKTKLRGLNYSEILRLRQSERMSQDDFQSPPIIELRERIQPEI
LELIKQQRLNRLCEGSCFRKLGNRRRQEKFWFCRLSLNHKVLHYGDLDESPQGEVPFELL
SDKIPVSDIKSVVTGKDCPHMKEKSALKQNKEVLELAFSVLYDPDETLNFVAPNKYEYCI
WTDGLCALLGREMGSDLTRSDLDTLISMEMKLRLLDLENITIPEAPPPVPKEPSSYNFTY
NYS
Download sequence
Identical sequences I3KT11
ENSONIP00000024257 ENSONIP00000024257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]