SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024268 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024268
Domain Number 1 Region: 6-386
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-104
Family Cystathionine synthase-like 0.000000000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024268   Gene: ENSONIG00000019283   Transcript: ENSONIT00000024289
Sequence length 391
Comment pep:known_by_projection scaffold:Orenil1.0:GL831162.1:3947961:3951884:-1 gene:ENSONIG00000019283 transcript:ENSONIT00000024289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSISVPPPKCLQKPLTVPYRHMFGPGPSNVPSRILEAGVNPVIGHMHPEIFEIMNDIKS
GIQYMFQTQNKMTLAVSGTGHSAMECAIFNAVEPGDSVLVAVNGIWGERAAEMAERIGAR
VNTIVAPPGGCFTIEEMEKALSKHRPVLLFVAHGESSTGVLHPLDGIGQLCHKYNCLFLV
DSVASIGGAPVYMDQQEIDILYTGSQKVLNAPPGTAPISFSERACQKIFSRRTKPVSFYL
DLSWLANYWGCDGKPSRVYHHTGPVTAFYSLRESLSVLVEEGLENSWERHLKVAEYFHAG
LESMGLKLFVKEKRLRLPTVTTIVAPYGYDWKEITSYIMKTHNLEISGGLRPSVGLVLRV
GLMGCNSSRENVDMVLAALKDALKHCHKSKV
Download sequence
Identical sequences I3KT22
ENSONIP00000024268 ENSONIP00000024268 XP_013126189.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]