SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024282 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024282
Domain Number 1 Region: 30-433
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.53e-80
Family Cystathionine synthase-like 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024282   Gene: ENSONIG00000019296   Transcript: ENSONIT00000024303
Sequence length 440
Comment pep:known_by_projection scaffold:Orenil1.0:GL831162.1:4042600:4048365:1 gene:ENSONIG00000019296 transcript:ENSONIT00000024303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKLDDVPLVQGPTFSEHNFHHFSEMNLDRIYMDYNATTPPESEVIQAISEALQDAWGN
PSSNYIAGAKAKAIINQSRENVARMVGGKAEDIVFTSGGTEANNLVLHTAVEHFRKHCRA
AEQGAGHQNGCTGLPHIITSNVEHDSVKLVAQHLEKEGKADVTFVPVSKVTARVEVEDII
AAVRPNTCLISVMLANNETGVIMPLQEICQRIKSLNKQRERLRILLHTDAAQALGKIRVD
VSDLGVDYLTIVGHKFYAPRIGALYVNGPGTKTPLYPMLFGGGQERNFRPGTENTPMIAG
LGKAAELVTSNLSDYESHMQRIKLYLEERLQAVFAGRIRFNSHFLGSDILPNTCNVSILG
PRLQGWRVLSNCRRLLASVGAACHSDSGNRPSHILLSCGVPSEVAANAMRLSVGRETSEA
DVDAVVEDLRETVQLLEEMN
Download sequence
Identical sequences I3KT36
ENSONIP00000024282 ENSONIP00000024282 XP_003444259.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]