SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024516 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024516
Domain Number 1 Region: 31-464
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.06e-51
Family AAT-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024516   Gene: ENSONIG00000019474   Transcript: ENSONIT00000024537
Sequence length 471
Comment pep:novel scaffold:Orenil1.0:GL831278.1:1798425:1808827:-1 gene:ENSONIG00000019474 transcript:ENSONIT00000024537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVQEVNSRVRGIRAPVNLQGLAACISEQIAQGVKKPFKSVIDVSSGDPHKAGMPPISF
IRQVMAVCLYPELLKEKSLPLDVRQRAQKLLDMCSGGSVGSYSTTSIGLPEVQKSISEFI
TRRDGGVLSHPEDIILTIGSQKGLSVFLNLLTSGEGKTQTGVLTPMPCPHTLPMLLDMTG
LALVPYRLFEEQGWAVNLDELHRALEAGRVHCEPKAIYISNPGNPTGYVQDRETIEKVIR
FAATNCLIILAEEVHQGSVYGQDKEFISYKKVLSEMGKTYAETMELVSFHSISTAYIGEC
GLRGGYMEVVNIDPAVKKCLNFTPSAPVLPQLALELSLNPPRPEDSSYNSYTQEIHHIED
TLSQNAKRALEFLNRVEGMSCQPSMAGPFLYPRVHLPPHMVEEAKRLGVKADVLYCQRLL
EEEGICVGAGCENGQEDKNYHIRLCIMTPPSTLEEILARLRSFHHHLLEKL
Download sequence
Identical sequences I3KTS0
XP_005468320.1.78416 ENSONIP00000024516 ENSONIP00000024516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]