SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024518 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024518
Domain Number 1 Region: 37-55,84-461
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.51e-58
Family AAT-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024518   Gene: ENSONIG00000019475   Transcript: ENSONIT00000024539
Sequence length 473
Comment pep:novel scaffold:Orenil1.0:GL831278.1:1819277:1825219:-1 gene:ENSONIG00000019475 transcript:ENSONIT00000024539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTPEWMAVAQRVVGHLLSRRAVDQSLILQGAQKPFKKVIDVSSGDPHRADLQHVSFLRQ
VLAVCVHPQLLEDKCFPLDVKIRAQKLLEACDGASVGSYTASSGLRHVRQSIAEFIKRRD
GVPSYAQNIFISAGSQRAIMIAVKLLASGEGNTRTGVLIPAPCPHMLYNVLEEAGLVLVP
YQLTEEKGWAVDLDKLHQALKAARGNCEPRAIYISNPGNPTGHVQDRKSIEEVIQFAAAE
RLLLLADEVYQDSVYGKDREFISYKKVLFEMDRELAETVQLISFHSISSTCIGECGLRAG
YMEVVNMDPEVIYYFDNTLCGDISTPVTGQLALDLMVNPPQPGDSSYDTYIQETFFTLAT
MSRNAQLVHELLNKLPGVRCQPALGGIYVFPRLHLPCGIKAQAKLLGLKADVLYCQKLLE
EEGVLAGAGEHGEMTDSFHLRLCILVPHDTLVEVLARLASFHCRLIKEFSQKQ
Download sequence
Identical sequences I3KTS2
ENSONIP00000024518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]