SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025601 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025601
Domain Number 1 Region: 374-465
Classification Level Classification E-value
Superfamily TAFH domain-like 3.14e-33
Family TAFH domain-like 0.00000597
Further Details:      
 
Domain Number 2 Region: 641-688
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000103
Family TBP-associated factors, TAFs 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025601   Gene: ENSONIG00000020317   Transcript: ENSONIT00000025622
Sequence length 852
Comment pep:known_by_projection scaffold:Orenil1.0:GL831152.1:3853173:3866085:-1 gene:ENSONIG00000020317 transcript:ENSONIT00000025622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASTASTDSNTGHDPGKTLVVSSGVTFLPNHQGKVGSYLVQTFNGSQTMNSHNSGNAAT
LRGTIVTSGTGSSSSAAISVTAVNSGPVLSKGLASVTMPPSSNSVIQTPLMNSQSVVASA
QPVSQATGPTVTLVRTPMQTAGSGAVLNGNNSASPSVATSASSQTGIGMQTPLVNNGQPS
SSVAISAGTHIIKAEPPTTITESAPQPTVTPGAVTVPRTSATAAAATGGIRALTPQMLAP
RLPQATPGQPSIHNIQLPPGMVLIRSDSGQLLMIPQQTLAQMQAQAQGDLAPRATTPTNV
PPGQAPGNTVISRQVTPSTIIRPGCPAPASLTATTTLHRPPILQSSVGAAVPGMTSRTVS
QTAGTTVTSIAFSKETIENVKKCKNFLSTLIKLASSGKQSTETAATVRELVKDLLEGKLE
AEEFTSRLYKELNSSPQPYLVPFLTRSLPALRQLTPDSAAFIQQSQLAQPASGSVSSTST
TPTTVVLDSPAPRLPTPVSRPLLQPGINKPGQMPSLVLQPQQQRAILRPQVTLPTTPVMT
LRNQAPSHIVLGQQQVQLKELQPVPLRPEGPLGSKQVLVAALTPAQKNKLKEAGGTFKDD
DDINDVASMAGVNLSEESANILATNSITVGAVTHSCKDEAFLSYAILQRKMLEIGRRYGV
TELSPEVVNYVSHAAQQRLQNILEKVSQVAQQKNITFKEDNNYEQSSDVRTQLKFFEQLD
QLEKQRKEEQEREILLKAAKSRARQEDPEQLRLKQKAKEMQQQELAQMRQREANLTALAA
IGPRKKRKDSPSSSASAEGSGTGPSLSGGPASSGSRPTRQRITRVNLRDLLFCLENERFT
SRSHFLYKGFLK
Download sequence
Identical sequences I3KWV5
ENSONIP00000025601 XP_005450273.1.78416 XP_005450274.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]