SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025603 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025603
Domain Number 1 Region: 251-342
Classification Level Classification E-value
Superfamily TAFH domain-like 2.62e-33
Family TAFH domain-like 0.00000554
Further Details:      
 
Domain Number 2 Region: 634-681
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000102
Family TBP-associated factors, TAFs 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025603   Gene: ENSONIG00000020317   Transcript: ENSONIT00000025624
Sequence length 842
Comment pep:known_by_projection scaffold:Orenil1.0:GL831152.1:3854444:3865522:-1 gene:ENSONIG00000020317 transcript:ENSONIT00000025624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAVLNGNNSASPSVATSASSQTGIGMQTPLVNNGQPSSSVAISAGTHIIKAEPPTTITE
SAPQPTVTPGAVTVPRTSATAAAATGGIRALTPQMLAPRLPQATPGQPSIHNIQLPPGMV
LIRSDSGQLLMIPQQTLAQMQAQAQGDLAPRATTPTNVPPGQWLGPRSTCTQLMKTPVEQ
NIRLYNLQCMGSSIVCRAPGNTVISRQVTPSTIIRPGCPAPASLTATTTLHRPPILQSSV
GAAVPGMTSRTETIENVKKCKNFLSTLIKLASSGKQSTETAATVRELVKDLLEGKLEAEE
FTSRLYKELNSSPQPYLVPFLTRSLPALRQLTPDSAAFIQQSQLAQPASGSVSSTSTTPT
TVVLDSPAPRLPTPVSRPLLQPGINKPGQMPSLVSKIHLDVDSGSSCSTDNLIIWHSTYL
NGERTSFSCLESLCSPEEKSCLRNKGLLGKSIAKHDYQQSNVEVSSRTVSEILHYKMSNM
SVKVLSHPGLGNQRAILRPQVTLPTTPVMTLRNQAPSHIVLGQQQVQLKELQPGEDVSLT
TLLNVCVCVCAPFIGLVPLRPEGPLGSKQVLVAALTPAQKNKLKEAGGTFKDDDDINDVA
SMAGVNLSEESANILATNSITVGAVTHSCKDEAFLSYAILQRKMLEIGRRYGVTELSPEV
VNYVSHAAQQRLQNILEKVSQVAQQKNITFKEDNNYEQSSDVRTQLKFFEQLDQLEKQRK
EEQEREILLKAAKSRARQEDPEQLRLKQKAKEMQQQELAQMRQREANLTALAAIGPRKKR
KDSPSSSASAELDLIEGKSSKILSSRPTRQRITRVNLRDLLFCLENERFTSRSHFLYKGF
LK
Download sequence
Identical sequences I3KWV7
ENSONIP00000025603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]