SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025604 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025604
Domain Number 1 Region: 178-269
Classification Level Classification E-value
Superfamily TAFH domain-like 2.22e-33
Family TAFH domain-like 0.00000597
Further Details:      
 
Domain Number 2 Region: 445-492
Classification Level Classification E-value
Superfamily Histone-fold 7.39e-16
Family TBP-associated factors, TAFs 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025604   Gene: ENSONIG00000020317   Transcript: ENSONIT00000025625
Sequence length 656
Comment pep:known_by_projection scaffold:Orenil1.0:GL831152.1:3854444:3865315:-1 gene:ENSONIG00000020317 transcript:ENSONIT00000025625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVTVPRTSATAAAATGGIRALTPQMLAPRLPQATPGQPSIHNIQLPPGMVLIRSDSGQL
LMIPQQTLAQMQAQAQGDLAPRATTPTNVPPGQVLSLVKAPGNTVISRQVTPSTIIRPGC
PAPASLTATTTLHRPPILQTELVMHGIGKSGSCGPCSTWARTVSQTAGTTVTSIAFSKET
IENVKKCKNFLSTLIKLASSGKQSTETAATVRELVKDLLEGKLEAEEFTSRLYKELNSSP
QPYLVPFLTRSLPALRQLTPDSAAFIQQSQLAQPASGSVSSTSTTPTTVVLDSPAPRLPT
PVSRPLLQPGINKPGQMPSLVLQPQQQRAILRPQVTLPTTPVMTLRNQAPSHIVLGQQQV
QLKELQPVPLRPEGPLGSKQVLVAALTPAQKNKLKEAGGTFKDDDDINDVASMAGVNLSE
ESANILATNSITVGAVTHSCKDEAFLSYAILQRKMLEIGRRYGVTELSPEVVNYVSHAAQ
QRLQNILEKVSQVAQQKNITFKEDNNYEQSSDVRTQLKFFEQLDQLEKQRKEEQEREILL
KAAKSRARQEDPEQLRLKQKAKEMQQQELAQMRQREANLTALAAIGPRKKRKDSPSSSAS
AEGSGTGPSLSGGPASSGSRPTRQRITRVNLRDLLFCLENERFTSRSHFLYKGFLK
Download sequence
Identical sequences I3KWV8
ENSONIP00000025604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]