SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025753 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025753
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.69e-59
Family G proteins 0.0000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025753   Gene: ENSONIG00000020448   Transcript: ENSONIT00000025774
Sequence length 196
Comment pep:known_by_projection scaffold:Orenil1.0:GL831178.1:4407424:4408014:1 gene:ENSONIG00000020448 transcript:ENSONIT00000025774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFETYVADIEVDNKQVQLALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD
LRNDENVKNELSRLKLEPVKTEDGRAMATRIGAYDYLECSAKTKEGIWEVFDTATRAALQ
KRQTTPGGCFKCCVLM
Download sequence
Identical sequences I3KXA7
XP_005475020.1.78416 ENSONIP00000025753 ENSONIP00000025753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]