SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452196947|ref|YP_007477028.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452196947|ref|YP_007477028.1|
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.02e-71
Family Phosphate binding protein-like 0.0000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452196947|ref|YP_007477028.1|
Sequence length 276
Comment Glutamine ABC transporter, periplasmic glutamine-binding protein [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MLKMKKLFTLIVFSCLFVLVVAGCGSKKDEAKETNTKQGGAVEQIKKRGKLVVGVKNDTN
LFGLKNPSTGQVEGFDVDIAKALAKKILGDEKKLELKEVTSKTRIPLLKNGDIDAIIATM
TITEERKKEVDFSDVYFKAGQSLLVKKGSNIKSIDDIKQGVKVLAVKGSTSTNNIRQKSP
EATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNYEVVGKIFTDEPYGIAVQK
GADDLTKEINSLLKDMKANGEYDKLYEKWIGQKQEK
Download sequence
Identical sequences A0A0F6J4R1 A0A160GVE2 A0A1C9BN75 A0A1I4MN39 A0A1W6WII2 A0A243AF04 A0A243F1X8 A0A243KLW6 A0A2A2PCY3 M1QQJ5
gi|410672938|ref|YP_006925309.1| gi|452196947|ref|YP_007477028.1| gi|384184647|ref|YP_005570543.1| WP_000916477.1.13279 WP_000916477.1.13975 WP_000916477.1.17374 WP_000916477.1.23245 WP_000916477.1.23360 WP_000916477.1.33790 WP_000916477.1.41090 WP_000916477.1.54547 WP_000916477.1.57561 WP_000916477.1.5895 WP_000916477.1.62277 WP_000916477.1.69347 WP_000916477.1.70108 WP_000916477.1.71652 WP_000916477.1.7534 WP_000916477.1.75891 WP_000916477.1.80622 WP_000916477.1.84541 WP_000916477.1.84775 WP_000916477.1.8577 WP_000916477.1.91020 WP_000916477.1.93838 WP_000916477.1.9533 WP_000916477.1.9700 WP_000916477.1.97816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]