SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452197270|ref|YP_007477351.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452197270|ref|YP_007477351.1|
Domain Number 1 Region: 113-289
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000279
Family Phosphate binding protein-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452197270|ref|YP_007477351.1|
Sequence length 322
Comment lipoprotein, putative [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MKKQLLLCIWIMTGVIAGCSSETSHTNIVNIDKVEIVAPNVQGAGWDLTARAMQKTLTEE
KIFTKPITVTNKVGGSGDVGWKYTKQKGGHVLTINSSLLITNNLLGHSKLTYKDFTPLAT
LVSDWEVVVVSKDSNIENANELMKQLKQNKKNFKIGVAPGLGNDDHLSFVQVSKAFGINP
AELQFFVYDNKEKIINALTNKQIGAATMTLSEAEKQYKAGKIKILAVSAPKRIDRLPQIP
TWKEQGIDVIFQHWKGIMGPKDMTEEEVAYWDGVIKKMVESESWKGILRERGWNSYYKDS
GETRGFLEESNFRYEEMVEKEA
Download sequence
Identical sequences A0A0F6J371 A0A1W6WID6 M1PG98
gi|384184966|ref|YP_005570862.1| WP_000744403.1.17374 WP_000744403.1.23360 WP_000744403.1.33790 WP_000744403.1.57561 WP_000744403.1.5895 WP_000744403.1.62277 WP_000744403.1.71652 WP_000744403.1.80622 WP_000744403.1.84541 WP_000744403.1.8577 WP_000744403.1.91020 gi|452197270|ref|YP_007477351.1| gi|410673257|ref|YP_006925628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]