SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452197647|ref|YP_007477728.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452197647|ref|YP_007477728.1|
Domain Number 1 Region: 40-348
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.01e-70
Family Phosphate binding protein-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452197647|ref|YP_007477728.1|
Sequence length 358
Comment Ferric iron ABC transporter, iron-binding protein [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MKKTIFKAVATGMVFSLLMGCGAKKEESAGAKVKDDKLSGSLTVYTAIEEELVPIYLDSF
KKKYPDVKLNIVRDSTGVITAKLLAEGKNTQADVVWGTAASSLLALDKKDMLKGYSPKGA
DRVLPQFKDDKQPEKWVGNTAFMTGIAVNKEELKKKNLLMPESYEDLTKPEYKGTLVMPH
PASSGTGFLTVSAWLQIMGEDKGWDYMKKLHDNMASYTHSGSKPAKLAGAGEYPVGVSMV
YSALKEKQKGAPVEVVLPKEGLGWEVEANALIKKDNAKNDKLAQAFLDWAITDDVMKLYF
EKNGFATIKNDYKLPEGFPKDVTEKLYKKNDFKWAAENRDKILEKWEKEFGQKAEPKK
Download sequence
Identical sequences A0A0F6JC89 A0A1W6WJJ5 M1QSL3
gi|410673626|ref|YP_006925997.1| gi|452197647|ref|YP_007477728.1| WP_000750891.1.23360 WP_000750891.1.33790 WP_000750891.1.57561 WP_000750891.1.5895 WP_000750891.1.62277 WP_000750891.1.71652 WP_000750891.1.80622 WP_000750891.1.84541 WP_000750891.1.8577 WP_000750891.1.91020 gi|384185336|ref|YP_005571232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]