SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452198015|ref|YP_007478096.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452198015|ref|YP_007478096.1|
Domain Number 1 Region: 42-336
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.91e-69
Family Phosphate binding protein-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452198015|ref|YP_007478096.1|
Sequence length 341
Comment Ferric iron ABC transporter, iron-binding protein [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MKKFSSLKSLFVCTLLFSAVVTGCSSKTGNADAKSKNTTEKKIVVYSAGPKGLAEKIQKD
FEKKTGIKVEMFQGTTGKILARMEAEKKNPVVDVVVLASLPAMEGLKKEGQTLAYKEAKQ
ADKLRSEWSDDKGHYFGYSASALGIVYNTKNVKTAPEDWSDITKGEWKGKVNLPDPALSG
SALDFVTGYVKKNGKDGWNLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIAGVDYMTYS
AKAKGEPVDIVYPKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQKQVSKAYLLPG
RTDIKAENRPNVEEIPVLNIDWKTVEKEQDEIGKQFKKVFQ
Download sequence
Identical sequences A0A0F6JDA4 A0A0J7H2K4 A0A1I4AUX6 A0A1W6WLD8 A0A242ZVN4 M1PI96 N1LU52 V5M7W3
WP_000714686.1.11521 WP_000714686.1.13975 WP_000714686.1.17374 WP_000714686.1.23245 WP_000714686.1.23360 WP_000714686.1.3249 WP_000714686.1.33790 WP_000714686.1.39957 WP_000714686.1.40034 WP_000714686.1.41090 WP_000714686.1.47975 WP_000714686.1.57561 WP_000714686.1.5895 WP_000714686.1.62277 WP_000714686.1.69347 WP_000714686.1.71652 WP_000714686.1.75891 WP_000714686.1.80622 WP_000714686.1.84541 WP_000714686.1.84775 WP_000714686.1.8577 WP_000714686.1.88269 WP_000714686.1.90254 WP_000714686.1.91020 WP_000714686.1.9700 WP_000714686.1.97816 gi|452198015|ref|YP_007478096.1| gi|384185692|ref|YP_005571588.1| gi|558680205|ref|YP_008818334.1| gi|410673989|ref|YP_006926360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]