SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452199210|ref|YP_007479291.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452199210|ref|YP_007479291.1|
Domain Number 1 Region: 26-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.98e-82
Family Phosphate binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452199210|ref|YP_007479291.1|
Sequence length 285
Comment Glycine betaine ABC transport system, glycine betaine-binding protein OpuAC [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MRKKIWFICLALFITMIFTSCNATNANSKGKIKLGVTSWKENIATANMWKVLLEEKGYKV
ELMYLEKAAIWTGVARGDVDANLEVWLPVTDKPLNDRYKDDIVLKSKWYEGTGLGLVVPS
YMKNINSIEDLNAHKDELDNKIVGIEPGSSLMNLTNKAMKEYDIKLKLVQSSEAAMMSEL
KKAYTKKKPIAVTLWNPHWGFSEFDLKYLKDPKKVYGEKDDIYYSVRKGFEKDHPDVIKY
FDKWKMNDEQLGTLMVMLNKTKDPEEAARKWIKKNQALVDEWVKD
Download sequence
Identical sequences A0A0F6J5P7 A0A0J7GT40 A0A0K0QD62 A0A1I4JCN0 A0A1M6XDC9 A0A1Q9KQ25 A0A242ZZ14 A0A243DJR6 A0A243EZB7 A0A243FWC3 A0A243I3I1 A0A243KCR5 A0A243KES6 A0A243LCX3 A0A2A2P6Y4 A0A2A9I4P6 C2UEV5 J8F0C6 J8MU11 J9C4J5 M1PLE8 N1LVM7 R8DUR8 R8FL38 R8FVX3 R8GH63 R8K948 R8TY13 S3IG50 V5MDK2
gi|558681296|ref|YP_008819425.1| gi|384186849|ref|YP_005572745.1| WP_001227615.1.100082 WP_001227615.1.10584 WP_001227615.1.11442 WP_001227615.1.13279 WP_001227615.1.14174 WP_001227615.1.17374 WP_001227615.1.22152 WP_001227615.1.22699 WP_001227615.1.23245 WP_001227615.1.23297 WP_001227615.1.23360 WP_001227615.1.23652 WP_001227615.1.25290 WP_001227615.1.26513 WP_001227615.1.26826 WP_001227615.1.28237 WP_001227615.1.3249 WP_001227615.1.33790 WP_001227615.1.34061 WP_001227615.1.3798 WP_001227615.1.3925 WP_001227615.1.39957 WP_001227615.1.40818 WP_001227615.1.44956 WP_001227615.1.45317 WP_001227615.1.47975 WP_001227615.1.5025 WP_001227615.1.54547 WP_001227615.1.57561 WP_001227615.1.5895 WP_001227615.1.60255 WP_001227615.1.60334 WP_001227615.1.62277 WP_001227615.1.63902 WP_001227615.1.69347 WP_001227615.1.71652 WP_001227615.1.72752 WP_001227615.1.74651 WP_001227615.1.7534 WP_001227615.1.75891 WP_001227615.1.75942 WP_001227615.1.76155 WP_001227615.1.77402 WP_001227615.1.79549 WP_001227615.1.80622 WP_001227615.1.84541 WP_001227615.1.84775 WP_001227615.1.85667 WP_001227615.1.8577 WP_001227615.1.86619 WP_001227615.1.86763 WP_001227615.1.87768 WP_001227615.1.88154 WP_001227615.1.90352 WP_001227615.1.90452 WP_001227615.1.91020 WP_001227615.1.91367 WP_001227615.1.93838 WP_001227615.1.94914 WP_001227615.1.9533 WP_001227615.1.95576 WP_001227615.1.96272 WP_001227615.1.96287 WP_001227615.1.9700 WP_001227615.1.97262 WP_001227615.1.97816 WP_001227615.1.98604 gi|410675155|ref|YP_006927526.1| gi|452199210|ref|YP_007479291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]