SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452200463|ref|YP_007480544.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452200463|ref|YP_007480544.1|
Domain Number 1 Region: 42-407
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.78e-93
Family Phosphate binding protein-like 0.00000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452200463|ref|YP_007480544.1|
Sequence length 419
Comment Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MKKALSLLTVSALSIGMLSACGPKDSGKKEESKAKKDYDLLVWEDEKKGVGLEPAVKSFE
KKYNVKVKVEEVQMTKQIEKLRLDGPAGTGPDVVTLPHDHIGNAVTEGLLSEVKVDDTVK
SKFTDLSIEAQTYNGKIYGLPKAIETPIFIYNKKMMQKAPETMDELFNFSKDFTKDGKYG
FLALGDNFYFANAFMAGMGGYVFGEKDGKPNANDIGLNNSGAVQGAEYIQKWYKEKLFPK
GIIGESGGSAADGLFNEGKAASIMNGPWAFQAMEKAGIDYGVAPMPKLPNGQPMKTFVGV
KGWHVTSFSKQNDLATKFTEWVTNEENAKIRFEKTKEIPPVKSVMEDPIIKENEAAKAVA
TQSENGIPMPNIPEMQEVWKPAGDALQLVVSDKEAPKSALDSAVKQIKGNIEANHSKKK
Download sequence
Identical sequences A0A0F6JGB3 A0A0Q0QZZ9 A0A0Q9G2L8 A0A0Q9GY66 A0A150DJB8 A0A160LE40 A0A1H6BXC4 A0A1I4FV97 A0A1M7EUJ1 A0A242XTV1 A0A243BD91 A0A243ED52 A0A243F424 A0A243FL55 A0A243M6I3 A0A2A2P357 A0A2A8YL97 A0A2A9HPJ5 B7IVQ3 J3UUP6 J7WW17 J8CQV6 J8MFQ4 J8YLQ8 M1QK39 R8CEP4 R8IX30 R8YKU9 S3IMZ2 V5MFR5
gi|410676395|ref|YP_006928766.1| gi|434377119|ref|YP_006611763.1| gi|218899172|ref|YP_002447583.1| gi|384188078|ref|YP_005573974.1| gi|402564575|ref|YP_006607299.1| gi|452200463|ref|YP_007480544.1| 405531.BCG9842_B1120 gi|558682632|ref|YP_008820761.1| WP_000709931.1.100497 WP_000709931.1.101720 WP_000709931.1.101838 WP_000709931.1.11442 WP_000709931.1.11521 WP_000709931.1.12553 WP_000709931.1.12935 WP_000709931.1.13269 WP_000709931.1.17374 WP_000709931.1.22084 WP_000709931.1.23245 WP_000709931.1.23360 WP_000709931.1.26459 WP_000709931.1.27446 WP_000709931.1.28599 WP_000709931.1.3249 WP_000709931.1.33790 WP_000709931.1.34061 WP_000709931.1.34537 WP_000709931.1.3546 WP_000709931.1.35769 WP_000709931.1.36279 WP_000709931.1.38325 WP_000709931.1.3925 WP_000709931.1.40034 WP_000709931.1.40818 WP_000709931.1.4355 WP_000709931.1.4447 WP_000709931.1.48759 WP_000709931.1.52284 WP_000709931.1.54547 WP_000709931.1.57561 WP_000709931.1.57732 WP_000709931.1.58712 WP_000709931.1.5895 WP_000709931.1.59384 WP_000709931.1.60526 WP_000709931.1.61799 WP_000709931.1.61820 WP_000709931.1.61919 WP_000709931.1.62277 WP_000709931.1.6241 WP_000709931.1.64421 WP_000709931.1.69347 WP_000709931.1.71652 WP_000709931.1.72752 WP_000709931.1.73638 WP_000709931.1.75942 WP_000709931.1.77402 WP_000709931.1.80622 WP_000709931.1.83666 WP_000709931.1.84541 WP_000709931.1.84775 WP_000709931.1.8577 WP_000709931.1.86763 WP_000709931.1.87649 WP_000709931.1.87705 WP_000709931.1.88269 WP_000709931.1.89145 WP_000709931.1.89325 WP_000709931.1.90254 WP_000709931.1.90452 WP_000709931.1.91367 WP_000709931.1.92555 WP_000709931.1.93838 WP_000709931.1.9533 WP_000709931.1.96272 WP_000709931.1.97821 WP_000709931.1.97830 WP_000709931.1.98315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]