SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452201266|ref|YP_007481347.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452201266|ref|YP_007481347.1|
Domain Number 1 Region: 32-259
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.19e-34
Family Phosphate binding protein-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452201266|ref|YP_007481347.1|
Sequence length 335
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MKKLIAIFCIMLLAVFTFAACSSKKEGTKEQTQNIRVGEVTHSLFYAPLYVGIEKGFFKD
EGLNIDLQTTAGGDKTMTALLSGGIDIALVGSETSIYVHQQGAKDPVINFAQLTQTDGTF
LVSRKKLDSFNWNDVKGVTFLGQRKGGMPQMVGEYVLKKNGIDPHKDTNLIQNIEFANIA
NAFASGTGEFVQLFEPTASILEKEGKGYIVASFGNESGTVPYTTFMAKESFLKKDKAAAE
KFTRALYKAQQWVDTHSPEEIADAVSPLFKDTSKDITVKVIERYKKQHSYATNPLLDAEE
WKQLQTIMKDAGELQKEVPHEALVNTKIAESVIKK
Download sequence
Identical sequences A0A0D0RQ25 A0A0D0RU17 A0A0F6JE26 A0A0K0QIS4 A0A243KBT7 M1QTL8 R8E4N6 R8FBG1 R8G4U5 R8G9Q7 R8JZP2
WP_000733140.1.84614 gi|384188862|ref|YP_005574758.1| gi|410677184|ref|YP_006929555.1| gi|452201266|ref|YP_007481347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]