SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452201502|ref|YP_007481583.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452201502|ref|YP_007481583.1|
Domain Number 1 Region: 29-269
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.8e-79
Family Phosphate binding protein-like 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452201502|ref|YP_007481583.1|
Sequence length 270
Comment Methionine ABC transporter substrate-binding protein [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEIK
KFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEVAGKIHLEPIGVYSQKYKSL
KELPDGATIIMSNSVADHGRGLAILQKEGILKIKDGVDPVKATPKDIADNPKNLKFKTDI
EPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGNDSPYANIVAVRKGDKDKKE
IKALVEVLHSKEIEDFINKEYKGAVVPVKE
Download sequence
Identical sequences A0A0F6J1W1 A0A160H522 A0A1B1LEZ2 A0A243A7Z1 A0A243FE78 A0A2A2P1B8 M1R2S3 V5MHS5
gi|410677427|ref|YP_006929798.1| gi|558683703|ref|YP_008821832.1| gi|452201502|ref|YP_007481583.1| gi|384189095|ref|YP_005574991.1| WP_000735081.1.11442 WP_000735081.1.17374 WP_000735081.1.23245 WP_000735081.1.23360 WP_000735081.1.3249 WP_000735081.1.33790 WP_000735081.1.41090 WP_000735081.1.41729 WP_000735081.1.54547 WP_000735081.1.57561 WP_000735081.1.5895 WP_000735081.1.62277 WP_000735081.1.71652 WP_000735081.1.7534 WP_000735081.1.80622 WP_000735081.1.84541 WP_000735081.1.84775 WP_000735081.1.8577 WP_000735081.1.91020 WP_000735081.1.93838 WP_000735081.1.9533 WP_000735081.1.9700 WP_000735081.1.97816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]