SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386761332|ref|YP_006234967.1| from Helicobacter cinaedi PAGU611

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386761332|ref|YP_006234967.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.92e-35
Family Ribosomal protein L6 0.0000699
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.24e-20
Family Ribosomal protein L6 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386761332|ref|YP_006234967.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Helicobacter cinaedi PAGU611]
Sequence
MSRVGKKPISIPKGVEVSLQGSKILFKGAKGQKELETYGRVKIDLQGDALSFACVDSQAQ
SRAYWGTYRALANNIVVGLSQGFSKVLEINGVGYKASINGKNLEMALGFSHPVVYPIPAG
IEMSVDKNTITIKGTDKQQVGQIAAEIREFRPPEPYKGKGIKYSDETIVRKAGKTSKK
Download sequence
Identical sequences I7GT47
gi|471315124|ref|YP_007600479.1| WP_002956259.1.1385 WP_002956259.1.82988 WP_002956259.1.88286 gi|386761332|ref|YP_006234967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]