SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386761396|ref|YP_006235031.1| from Helicobacter cinaedi PAGU611

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386761396|ref|YP_006235031.1|
Domain Number 1 Region: 11-298
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.95e-80
Family EF1021-like 0.0000000982
Further Details:      
 
Domain Number 2 Region: 299-412
Classification Level Classification E-value
Superfamily SCP-like 1.57e-28
Family EF1021 C-terminal domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386761396|ref|YP_006235031.1|
Sequence length 412
Comment GNAT family acetyltransferase [Helicobacter cinaedi PAGU611]
Sequence
MKKTQIRERLTMQQLDISHIEQFNELLRYAFQVTDSDLLEFGWNNEEIKRSKYPILQNAI
VLGWFDRQKLISQIALYPMQMNIYNRIYAMGGITGVATYPEYSGIGLMADLMREILKMMR
EKGQSISCLYPYSIPYYRSRGWEIVSDKMSFVIKDNQFPKPPQVGGMMQRVTEDHPDLKA
LHNEFAAKTHGCLVRDILAWNEYWRWDVEDTIVAIYYDECDKPTGYIVYLLENDIFKIKE
MIYLNEEARYGLWGYINAHQSMFDSIEGANFSNHNLAFLLEDGHIKESIQPYIMARIVDV
EQFLTQYPFEFVKSNMCLRFSVSDPLLEWNNRDFILHFKDGELALQVVASEKKQKLGEYY
IKLDIQTLTTMLLGYKRPLYLRSINRLKANDESIDKLEEILPEGKAYFSDYF
Download sequence
Identical sequences WP_014666538.1.82988 gi|386761396|ref|YP_006235031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]